PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010911998.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Arecoideae; Cocoseae; Elaeidinae; Elaeis
Family bZIP
Protein Properties Length: 292aa    MW: 31629.5 Da    PI: 9.9327
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010911998.1genomeOGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_149.59.4e-16210266359
                     XXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
          bZIP_1   3 elkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevakl 59 
                     +l+r++r++kNRe+A rsR+RK+a+++eLe  v +Le+eN +L k  ee  ke  + 
  XP_010911998.1 210 ALQRQKRMIKNRESAARSRERKQAYTAELESLVSQLEEENVQLLKYQEEQHKERLQQ 266
                     79***************************************9998777766665554 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1705.9E-14203269No hitNo description
SMARTSM003382.2E-10208272IPR004827Basic-leucine zipper domain
PfamPF001701.3E-14209267IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.461210262IPR004827Basic-leucine zipper domain
CDDcd147074.75E-20212266No hitNo description
SuperFamilySSF579592.31E-10212263No hitNo description
PROSITE patternPS000360215230IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 292 aa     Download sequence    Send to blast
MAKPNSNPRI PRMASSRVMA SSSSANSDLA RQSSIFPQAV ADLQGSAGGD PLKTLGSMSM  60
EDLLRVYPEN AAPFASEDAG SGGEASASGS QQGSLALPKE IGSKTVEEVW REIAAGRKAD  120
GGDRSGGQMT LEDFLARAGA VREEELRVPS GSVQGGFGLD SAMGGAFSQQ QQLPLENPVI  180
GFGNEVHGGG GRRGGRGRKR PVLDPVDRAA LQRQKRMIKN RESAARSRER KQAYTAELES  240
LVSQLEEENV QLLKYQEEQH KERLQQLMEN VIPVTEKKKP KRPLRRTCSM QW
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1275282EKKKPKRP
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010912002.10.0PREDICTED: G-box-binding factor 4-like isoform X1
RefseqXP_010912001.10.0PREDICTED: G-box-binding factor 4-like isoform X1
RefseqXP_010911998.10.0PREDICTED: G-box-binding factor 4-like isoform X1
RefseqXP_010911997.10.0PREDICTED: G-box-binding factor 4-like isoform X1
TrEMBLM0SGW36e-98M0SGW3_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr3P22470_0012e-97(Musa acuminata)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G44080.14e-31bZIP family protein