PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010911943.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Arecoideae; Cocoseae; Elaeidinae; Elaeis
Family Dof
Protein Properties Length: 300aa    MW: 32843.6 Da    PI: 4.8142
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010911943.1genomeOGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof120.46.3e-383085661
          zf-Dof  6 lkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61
                     +cprCds ntkfCyynnyslsqPryfCk+CrryWtkGG+lrnvPvGgg+rkn++ 
  XP_010911943.1 30 PNCPRCDSPNTKFCYYNNYSLSQPRYFCKGCRRYWTKGGSLRNVPVGGGCRKNRRG 85
                    58***************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074786.0E-321684IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.8543084IPR003851Zinc finger, Dof-type
PfamPF027016.3E-323084IPR003851Zinc finger, Dof-type
PROSITE patternPS0136103268IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 300 aa     Download sequence    Send to blast
MLSSWDNILP CPTRPVMVDR RWKPNVEIAP NCPRCDSPNT KFCYYNNYSL SQPRYFCKGC  60
RRYWTKGGSL RNVPVGGGCR KNRRGKSVRL STVVPPDLSY GRRLSGQIRP DLALDGMVGN  120
STGSVQSMDA STTTDGSTID LALLYAKFLN QHPVVEPGLG VTELPGGIDE SFDSSGRQSD  180
TNLNQQTPAP LPNQYNLVEC QRVSEPIAEA LLGDGDQQSI GNHDLPVDPS AYESPAFPTE  240
GISSFLSSNC PGVPNLASEA ANYQGFGSLQ LEDSMALHQN LIVNDWSTMD YSSLEAFYWS
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00405DAPTransfer from AT3G52440Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010911943.10.0uncharacterized protein LOC105037989
TrEMBLA0A2H3X8G80.0A0A2H3X8G8_PHODC; dof zinc finger protein DOF3.5-like
STRINGXP_008779883.10.0(Phoenix dactylifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP26593683
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G52440.11e-39Dof family protein