PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010911133.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Arecoideae; Cocoseae; Elaeidinae; Elaeis
Family bZIP
Protein Properties Length: 144aa    MW: 16751.2 Da    PI: 6.6821
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010911133.1genomeOGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_137.26.5e-122381563
                    CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
          bZIP_1  5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63
                    ++ +r+ +NRe+ArrsR +K+  ++ L + +++L +eN+    +++ +++ + +l++e+
  XP_010911133.1 23 RKRKRMLSNRESARRSRMKKQHHLDDLINQAAQLRNENEHIVMQANLITQRYTELETEN 81
                    57899***********************************************9999876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.2E-161983IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.8062184IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.85E-112376No hitNo description
PfamPF001701.1E-82364IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1707.0E-102368No hitNo description
CDDcd147029.32E-192474No hitNo description
PROSITE patternPS0003602641IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1701.2E-46998No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006971Biological Processhypotonic response
GO:0009267Biological Processcellular response to starvation
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:2000693Biological Processpositive regulation of seed maturation
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 144 aa     Download sequence    Send to blast
MSSLPAHQSF ESKGNPQLVM DERKRKRMLS NRESARRSRM KKQHHLDDLI NQAAQLRNEN  60
EHIVMQANLI TQRYTELETE NSVLRAQVME LTERLQSLNS VLHIFEEVSG MAMDIPEIPD  120
PLLRPWQLPC PAQPIMATAD MFQF
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00419DAPTransfer from AT3G62420Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010911133.11e-103PREDICTED: ocs element-binding factor 1-like
SwissprotQ9LZP84e-56BZP53_ARATH; bZIP transcription factor 53
TrEMBLM0RPJ44e-67M0RPJ4_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr11P05140_0011e-66(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP188635100
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G62420.12e-57basic region/leucine zipper motif 53