PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010910040.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Arecoideae; Cocoseae; Elaeidinae; Elaeis
Family Dof
Protein Properties Length: 350aa    MW: 37326.4 Da    PI: 8.6361
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010910040.1genomeOGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof127.25e-402686262
          zf-Dof  2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62
                    +e+ lkcprCds ntkfCyynnysl+qPr+fCk+CrryWtkGGalrnvPvGgg+rknkks+
  XP_010910040.1 26 PEQGLKCPRCDSPNTKFCYYNNYSLTQPRHFCKTCRRYWTKGGALRNVPVGGGCRKNKKSK 86
                    67899*****************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF027014.7E-332884IPR003851Zinc finger, Dof-type
ProDomPD0074788.0E-272984IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.5343084IPR003851Zinc finger, Dof-type
PROSITE patternPS0136103268IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010052Biological Processguard cell differentiation
GO:0010118Biological Processstomatal movement
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:1902066Biological Processregulation of cell wall pectin metabolic process
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 350 aa     Download sequence    Send to blast
MMVSPAADDS QTSGGPKSTT TPLRPPEQGL KCPRCDSPNT KFCYYNNYSL TQPRHFCKTC  60
RRYWTKGGAL RNVPVGGGCR KNKKSKSSAS IRLPLDPTNP ITAGIPEPGG GLKFLAGPSP  120
PAVDFQLGVL PFTRLHAPTT CGVLSIGNQF ISFEDFSSST AISSPAATMA SSMGGFNYPT  180
SSIGFYSDVG GGSSPTANSN TLGNIASSIE SLSSVNQDIH WKLQQQRLAM FFGRETRRES  240
SVSPLPTPFL ENQPEPVSFQ VPESSRAHVC GNNGSRSGCV SSTETPPTWF IDSSYTMPTS  300
ATANNTTNSH NISAATTNNQ NNNKNSGDNN SSNWNGIPAW NDMTQFASLP
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010910040.10.0dof zinc finger protein DOF5.7-like
TrEMBLA0A2H3Z9I30.0A0A2H3Z9I3_PHODC; dof zinc finger protein DOF5.7
STRINGXP_008810154.10.0(Phoenix dactylifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP14037367
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G65590.14e-52Dof family protein