PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010909355.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Arecoideae; Cocoseae; Elaeidinae; Elaeis
Family Dof
Protein Properties Length: 342aa    MW: 36381.5 Da    PI: 8.1512
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010909355.1genomeOGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof127.24.9e-403292262
          zf-Dof  2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62
                    +e+ lkcprCds ntkfCyynnysl+qPr+fCk+CrryWtkGGalrnvPvGgg+rknkks+
  XP_010909355.1 32 PEQGLKCPRCDSPNTKFCYYNNYSLTQPRHFCKTCRRYWTKGGALRNVPVGGGCRKNKKSK 92
                    67899*****************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF027014.5E-333490IPR003851Zinc finger, Dof-type
ProDomPD0074783.0E-273590IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.5343690IPR003851Zinc finger, Dof-type
PROSITE patternPS0136103874IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 342 aa     Download sequence    Send to blast
MVSPAADDSQ TSGGRKTAAA ATTTTTNPLH PPEQGLKCPR CDSPNTKFCY YNNYSLTQPR  60
HFCKTCRRYW TKGGALRNVP VGGGCRKNKK SKSSASTRLP LDPADPIVGI PEHGSALKFL  120
TGPSQPAVDF QLGVLPFSRL QLPTTSGVFS SSNNQFFSFA DFPSATAISS PAVTTASSMV  180
GFSYPISSVG LYGEMGGGLS SMVSSNTHSS IASSIESLSS INQDLHWKLQ QQRLAMLFGV  240
EAHKESTLSA LPTPLLEKQP EPIAFQLPDC TRAEDCGGSG SRSGCVGTTE TAAWFHESSY  300
TMPASATNNS RDNNTSSSGN NNSSNWNGIP AWNDMPQFTT LP
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010909355.20.0dof zinc finger protein DOF5.7-like
TrEMBLA0A2H3Z9I31e-166A0A2H3Z9I3_PHODC; dof zinc finger protein DOF5.7
STRINGXP_008810154.11e-167(Phoenix dactylifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP14037367
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G65590.11e-46Dof family protein