PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010909006.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Arecoideae; Cocoseae; Elaeidinae; Elaeis
Family bZIP
Protein Properties Length: 398aa    MW: 43787.4 Da    PI: 6.1234
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010909006.1genomeOGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_131.24.7e-10200258563
                     CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
          bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                     kr++r+  NR +A rs +RK  +i eLe+ v++L++  ++L  +l +l+     l++e+
  XP_010909006.1 200 KRAKRMWANRQSAARSKERKMRYISELERQVQSLQTDATTLSAQLTMLQRDTNGLTAEN 258
                     9**********************************************999888887776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003387.6E-16196260IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.852198261IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1705.8E-10200254No hitNo description
PfamPF001701.8E-8200254IPR004827Basic-leucine zipper domain
SuperFamilySSF579595.49E-11200251No hitNo description
CDDcd147033.29E-23201250No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 398 aa     Download sequence    Send to blast
MDKGKAPVHG EGAGSPPHSS RFSASFSPFS SNFPELGDPL RSSSSQPIQE SSQDVSLMPD  60
FLPRNLGHRR AHSDILGLPD DISFYSDLGV VGSHDDIDDD LLSAYFDNEN FNSPPPSSSG  120
PSCGEPSGLA AAPPAPLQTE NLVSASNERP GAGHQHSQSM DGSFSVLLGT SGEGPGLTPA  180
EMKKAVEDAK LADLALVDPK RAKRMWANRQ SAARSKERKM RYISELERQV QSLQTDATTL  240
SAQLTMLQRD TNGLTAENSE LKLQLQTMEQ QVHFQDALND ALQEEVQRLK LATGQLMPNG  300
GPMMNFGHPS FGASQQFYHH NQSMQSLMAA QQFQQLHIHS QHQQQLHQLQ PLQQQQLHLH  360
QHQQGQQQPP VDLRMKGPMT YQNKRAEGPS DNNNNQRE
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010909006.10.0PREDICTED: transcription factor RF2a-like
SwissprotQ040881e-110POF21_ARATH; Probable transcription factor PosF21
TrEMBLM0U5801e-133M0U580_MUSAM; Uncharacterized protein
STRINGGSMUA_AchrUn_randomP00680_0011e-132(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP42693868
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G06070.11e-103bZIP family protein