PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010908824.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Arecoideae; Cocoseae; Elaeidinae; Elaeis
Family Dof
Protein Properties Length: 241aa    MW: 25123.2 Da    PI: 8.374
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010908824.1genomeOGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof112.12.5e-353286559
          zf-Dof  5 alkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknk 59
                      +cprC+s++tkfCyynny++sqPr+fC++CrryWt GG+lrnvP+Gg++rk+ 
  XP_010908824.1 32 RERCPRCNSRDTKFCYYNNYNTSQPRHFCRSCRRYWTLGGSLRNVPIGGSSRKRL 86
                    568*************************************************975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5088427.8663387IPR003851Zinc finger, Dof-type
PfamPF027011.3E-303385IPR003851Zinc finger, Dof-type
PROSITE patternPS0136103571IPR003851Zinc finger, Dof-type
ProDomPD0074788.0E-184083IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 241 aa     Download sequence    Send to blast
MQTKRMPSET GEGRRRPAEG PAEEEAAAER GRERCPRCNS RDTKFCYYNN YNTSQPRHFC  60
RSCRRYWTLG GSLRNVPIGG SSRKRLRPSP ASAAATATVH SLRPLPSLSS QAPSLDLPST  120
TSPPSAFGSL LPGPVSAGFL ALGEPFLDRR TGFELGLGLG LRSGPAASPS IEELGFGLGT  180
TLLWPTALLD EEGVIGGGDT WRVGGGGTDC FGAPGPAAVW PDLAIAAAPA EGSGGAGGEL  240
R
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010908824.11e-170dof zinc finger protein DOF1.6-like
TrEMBLA0A3Q0I6M51e-122A0A3Q0I6M5_PHODC; dof zinc finger protein MNB1A-like
STRINGXP_008813223.16e-97(Phoenix dactylifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP14037367
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G21270.14e-22DOF zinc finger protein 2