PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010908383.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Arecoideae; Cocoseae; Elaeidinae; Elaeis
Family Dof
Protein Properties Length: 351aa    MW: 37318.7 Da    PI: 8.3193
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010908383.1genomeOGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof124.24.3e-3953112261
          zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61 
                     ++++l+cprCds+ntkfCyynny+l+qPr+fCk+CrryWtkGGalrnvP+Ggg+rk k+s
  XP_010908383.1  53 QQQNLRCPRCDSSNTKFCYYNNYNLTQPRHFCKTCRRYWTKGGALRNVPIGGGCRKAKAS 112
                     68999***************************************************9976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074781.0E-2550110IPR003851Zinc finger, Dof-type
PfamPF027018.5E-3355111IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.23657111IPR003851Zinc finger, Dof-type
PROSITE patternPS0136105995IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 351 aa     Download sequence    Send to blast
MIQELLGGMV EERKISIPGS LLIDPSSSSS SSSSISSTSL SSASPSPSNT SEQQQNLRCP  60
RCDSSNTKFC YYNNYNLTQP RHFCKTCRRY WTKGGALRNV PIGGGCRKAK ASPAIPSGAS  120
KSGGTKAKPS PPDLLARSGI IGGLEHELPS SPLFWASPHT SHLMALLRAT TVQNPNPNPP  180
SSSTLNNSVR IKEDGAMIGT HMAADTVGAL PSQGLSLDPL GQLPLAPCGS LWRNNNQYAY  240
HQQPQTQQLQ QHSSNMLLGE VPSSAIQELY QRFKSSANYC NDQLQAVMSN VGCLDSSTSS  300
ATTAMTTTSS TVGTSTSASI LEPIPFSGGE FTYWNPALTW SDLPTTNGAF P
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010908383.10.0dof zinc finger protein DOF3.4-like
TrEMBLA0A2H3Y2U90.0A0A2H3Y2U9_PHODC; dof zinc finger protein DOF2.2-like
STRINGXP_008792599.10.0(Phoenix dactylifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP77103144
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G65590.12e-33Dof family protein