PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010907998.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Arecoideae; Cocoseae; Elaeidinae; Elaeis
Family bZIP
Protein Properties Length: 377aa    MW: 41069 Da    PI: 7.2004
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010907998.1genomeOGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_146.21e-14295340550
                     CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
          bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkele 50 
                     +r+rr++kNRe+A rsR+RK+a++ eLe + k+L++eN +Lk+e  
  XP_010907998.1 295 RRQRRMIKNRESAARSRARKQAYTVELEAELKQLKEENVRLKEEER 340
                     79****************************************7643 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.9E-12291355IPR004827Basic-leucine zipper domain
PROSITE profilePS5021711.082293338IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1704.0E-13295349No hitNo description
SuperFamilySSF579592.63E-10295343No hitNo description
PfamPF001703.2E-12295341IPR004827Basic-leucine zipper domain
CDDcd147071.21E-21295348No hitNo description
PROSITE patternPS000360298313IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 377 aa     Download sequence    Send to blast
MASTSERRKM TSDDRQKGEE KVERELDMEI PLMRQSSIYS LTLDEIQNTV CEPGKTFGSM  60
NMDEFLANIW NVEEGQIAHA AGSEAQPNGE GAPPPPPPPP LQRQVSISIP APLCRKTVDE  120
VWTEIHRGRK VDHPQQHGSD GADPRQVTLG EMTLEDFLIK AGVVREGYHQ VVAPSPHAPP  180
PPPVTQYGVP TGYQMVGLEG APVYGQVVGV QGYGDHQVAG NGMYEVFGDG GPGYSVGNGF  240
GERVRNGYGG SXSPGSEEGV GGGQVGKSGA AEGGGGGKLG RKRALDGAVE KVVERRQRRM  300
IKNRESAARS RARKQAYTVE LEAELKQLKE ENVRLKEEER KMLALKKQVL MESMAERARV  360
NAQKTVLMLR RCNSSPW
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010907998.10.0PREDICTED: LOW QUALITY PROTEIN: protein ABSCISIC ACID-INSENSITIVE 5-like
TrEMBLM0TNH71e-110M0TNH7_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr8P07740_0011e-109(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP38303558
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G49720.21e-34abscisic acid responsive element-binding factor 1