PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010907516.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Arecoideae; Cocoseae; Elaeidinae; Elaeis
Family Dof
Protein Properties Length: 302aa    MW: 32750.5 Da    PI: 8.0033
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010907516.1genomeOGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof128.32.3e-4045106263
          zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkksss 63 
                     +e+alkcprCds+ntkfCyynnyslsqPryfCk+CrryWtkGG+lrnvPvGgg+rknk+sss
  XP_010907516.1  45 PEQALKCPRCDSNNTKFCYYNNYSLSQPRYFCKGCRRYWTKGGSLRNVPVGGGCRKNKRSSS 106
                     6899******************************************************9875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074783.0E-253898IPR003851Zinc finger, Dof-type
PfamPF027012.1E-3347103IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.49749103IPR003851Zinc finger, Dof-type
PROSITE patternPS0136105187IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 302 aa     Download sequence    Send to blast
MEISNAHQQV MATLPLEEVL AGCPKTQQPQ QQQQQQQERK ARPPPEQALK CPRCDSNNTK  60
FCYYNNYSLS QPRYFCKGCR RYWTKGGSLR NVPVGGGCRK NKRSSSSTSK RVQDQTLTTH  120
STPPLPTFIP PPLSYDPSGL SLTFPRFHTP PTPGQLGLDD HDSFLLGNPN PNPSQIPTAT  180
PSFLDILRGG LLDTTTNSNA FHNLYHGFGG HGRMEEVEGG VSGEEVVLPF DGGLGGSTTS  240
TTASTPTASQ GSCKAVDGGE SRVFMGLQWQ VGRDGSMGMD PGREYWNGVG SSWPGLINSS  300
LM
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010907516.10.0dof zinc finger protein DOF3.2 isoform X1
TrEMBLA0A2H3XUN01e-174A0A2H3XUN0_PHODC; dof zinc finger protein DOF3.2-like isoform X1
STRINGXP_008789033.11e-175(Phoenix dactylifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP47043263
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G24060.11e-32Dof family protein