PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010907113.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Arecoideae; Cocoseae; Elaeidinae; Elaeis
Family bZIP
Protein Properties Length: 337aa    MW: 36879 Da    PI: 5.454
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010907113.1genomeOGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_129.61.5e-09204248549
                     CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
          bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkel 49 
                     +r +++++ Re+A r+ ++K+a++ eLe kv +L +eN +L++e 
  XP_010907113.1 204 RRMKKLMRSRESAARFHAKKQAYTRELEAKVNQLREENARLQEEE 248
                     578999***********************************9874 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003386.2E-4199264IPR004827Basic-leucine zipper domain
PROSITE profilePS502179.438202247IPR004827Basic-leucine zipper domain
CDDcd147074.83E-15202250No hitNo description
SuperFamilySSF579591.45E-7204259No hitNo description
PfamPF001702.4E-7204249IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1701.1E-9204260No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 337 aa     Download sequence    Send to blast
MDPNLPSSRQ PSIETIFLEH CDTFESLNMD NLLIPNPWSV EEETNTSATT STAADPNPTT  60
PVHRQGSPTL SIPGPLHRKI VDKVWAKIQK EKLPLMMNVG GAQRVDDLDA LPPSLSPYPC  120
EIAAIPMESV ACGDHQTLQE SGGRMEMSHF AVQQVKGESV LFSSTSAGGP TAGLGPCGGE  180
GMEWERGGMG RKGMNETNEK EMERRMKKLM RSRESAARFH AKKQAYTREL EAKVNQLREE  240
NARLQEEEQK NWATMSHLVQ ITTFYDSCRC TISSPITKSV VSAVQSVTSS MNQWMRKILS  300
AFPVAATTVA PGDEMPPIIA GSGPPMTPIG VLIVEVE
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010907113.10.0PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 2 isoform X1
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G56850.13e-12ABA-responsive element binding protein 3