PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Eucgr.L02193.1.p
Common NameEUGRSUZ_L021932, LOC104430407
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family bZIP
Protein Properties Length: 255aa    MW: 27382.1 Da    PI: 6.5259
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Eucgr.L02193.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_141.52.9e-1377134259
                       XXXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
            bZIP_1   2 kelkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevakl 59 
                       +++k+ rr  +NR AA rsR+RKka+++ Le k+k Le+e ++L   l++ + e ++l
  Eucgr.L02193.1.p  77 PASKKLRRQLRNRDAAVRSRERKKAYVKDLEVKSKYLEGECRRLGRLLQRVTAENQAL 134
                       689*****************************************99999999998877 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003385.7E-876140IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1701.1E-1178139No hitNo description
PfamPF001704.7E-1078134IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.20878134IPR004827Basic-leucine zipper domain
SuperFamilySSF579598.75E-1180136No hitNo description
CDDcd147049.36E-1781132No hitNo description
PROSITE patternPS0003608398IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0016021Cellular Componentintegral component of membrane
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 255 aa     Download sequence    Send to blast
MKDDEDGGVV GGGIRADSSQ EFCDRFLADV LVESPADGSA EIADGSGDKE EPGSSDDGGI  60
EAAKVDGANG GGEAYDPASK KLRRQLRNRD AAVRSRERKK AYVKDLEVKS KYLEGECRRL  120
GRLLQRVTAE NQALHFSLQN SECGASVAKL ESAVLSEPLP LGSLFWFLCI TWLFTLPLPL  180
LLALEAVLRE NTGKGNPKPL AAPRGARSEM FGSKFGCPRT GGSDGEVSLS VLTAFKLRTS  240
HRILFIYCIK LCNT*
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor involved in endoplasmic reticulum (ER) stress response (PubMed:21223397, PubMed:22050533, PubMed:22199238). Acts downstream of the ER stress sensors IRE1, BZIP39 and BZIP60 to activate BiP chaperone genes (PubMed:22050533, PubMed:22199238). {ECO:0000269|PubMed:21223397, ECO:0000269|PubMed:22050533, ECO:0000269|PubMed:22199238}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapEucgr.L02193.1.p
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By dithiothreitol-induced endoplasmic reticulum (ER) stress response (PubMed:22050533, PubMed:21223397). Induced by salt stress (PubMed:22050533). {ECO:0000269|PubMed:21223397, ECO:0000269|PubMed:22050533}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010041444.10.0PREDICTED: bZIP transcription factor 60
SwissprotQ69XV01e-32BZP50_ORYSJ; bZIP transcription factor 50
TrEMBLA0A058ZRB70.0A0A058ZRB7_EUCGR; Uncharacterized protein
STRINGXP_010041444.10.0(Eucalyptus grandis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM46342848
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G42990.12e-09basic region/leucine zipper motif 60
Publications ? help Back to Top
  1. Wakasa Y, et al.
    Expression of ER quality control-related genes in response to changes in BiP1 levels in developing rice endosperm.
    Plant J., 2011. 65(5): p. 675-89
    [PMID:21223397]
  2. Lu SJ, et al.
    Conservation of IRE1-regulated bZIP74 mRNA unconventional splicing in rice (Oryza sativa L.) involved in ER stress responses.
    Mol Plant, 2012. 5(2): p. 504-14
    [PMID:22199238]