PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Eucgr.K02841.1.p
Common NameEUGRSUZ_K02841, LOC104426266
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family Dof
Protein Properties Length: 338aa    MW: 36485.4 Da    PI: 7.0362
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Eucgr.K02841.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof126.21e-3952112262
            zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                       +++ lkcprC+st+tkfCyynnyslsqPryfCk+CrryWtkGG+lrn+PvGgg+rknkk+s
  Eucgr.K02841.1.p  52 HDQPLKCPRCESTHTKFCYYNNYSLSQPRYFCKTCRRYWTKGGTLRNIPVGGGCRKNKKAS 112
                       7899******************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074781.0E-2846106IPR003851Zinc finger, Dof-type
PfamPF027012.1E-3353110IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.05956110IPR003851Zinc finger, Dof-type
PROSITE patternPS0136105894IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010067Biological Processprocambium histogenesis
GO:0010087Biological Processphloem or xylem histogenesis
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 338 aa     Download sequence    Send to blast
MAFTSLQVCM DSSDWLQGTL HDDSGMDTSS PNSGDMLACS RPLMERRLRP QHDQPLKCPR  60
CESTHTKFCY YNNYSLSQPR YFCKTCRRYW TKGGTLRNIP VGGGCRKNKK ASNSGSNSNN  120
SASSKKLANN DHQGYGVPSH PGQSSASSSR GDHSTDLHLS FSPEVQLSHL HGLLGVHGAP  180
FAGPGNNFSG LENPRPIDFL EGKVMSYDSN FMLSGDSPHP HMGVVGDLGG STGLAPGFHG  240
FCGPYGMAID GGHSGNANSF MENCQRLNML VPYDQGHDQE QINAMDVKPN PKLLSLEWQD  300
QGCSDASKNG YGYFNGLGPS WTGMMNDYNA SASNPLV*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00580DAPTransfer from AT5G62940Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapEucgr.K02841.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3763883e-52AK376388.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv3122H18.
GenBankAM0843603e-52AM084360.1 Hordeum vulgare subsp. vulgare dof12 gene for dof zinc finger protein 12, exons 1-2.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010037561.10.0PREDICTED: dof zinc finger protein DOF5.6
TrEMBLA0A059A6H40.0A0A059A6H4_EUCGR; Uncharacterized protein
STRINGXP_010037561.10.0(Eucalyptus grandis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM63742746
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G62940.15e-46Dof family protein