PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Eucgr.K02809.1.p
Common NameEUGRSUZ_K02809, LOC104426236
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family LBD
Protein Properties Length: 195aa    MW: 20923.7 Da    PI: 8.1
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Eucgr.K02809.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260146.66.8e-4610108199
            DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkae 93 
                       +CaaCk+lrrkC ++C++apyfp e+p+kf nvhk+FGasnv+kll++lp+++reda++sl+yeAear+rdPvyG+vg i+ lq+q+++l++e
  Eucgr.K02809.1.p  10 PCAACKFLRRKCMPGCIFAPYFPPEEPQKFTNVHKIFGASNVTKLLNELPPHQREDAVNSLAYEAEARVRDPVYGCVGAISFLQRQVQRLQKE 102
                       7******************************************************************************************** PP

            DUF260  94 lallke 99 
                       l+++++
  Eucgr.K02809.1.p 103 LETANA 108
                       *99876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089128.0989110IPR004883Lateral organ boundaries, LOB
PfamPF031959.2E-4510107IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010199Biological Processorgan boundary specification between lateral organs and the meristem
Sequence ? help Back to Top
Protein Sequence    Length: 195 aa     Download sequence    Send to blast
MSSSSSYNSP CAACKFLRRK CMPGCIFAPY FPPEEPQKFT NVHKIFGASN VTKLLNELPP  60
HQREDAVNSL AYEAEARVRD PVYGCVGAIS FLQRQVQRLQ KELETANADL IRYACNGIPS  120
SAAIPGSNNP VQPVTLRQRA APLEFGGVGR PIGNEGGGAF YQAPLPPYPY PYPPLPWNDN  180
FGGDFNGGGG GGSM*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00581DAPTransfer from AT5G63090Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapEucgr.K02809.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010037527.11e-141PREDICTED: protein LATERAL ORGAN BOUNDARIES
SwissprotQ9FML42e-72LOB_ARATH; Protein LATERAL ORGAN BOUNDARIES
TrEMBLA0A059A6761e-141A0A059A676_EUCGR; Uncharacterized protein
STRINGPOPTR_0015s09370.11e-94(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM13128340
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G63090.43e-71LBD family protein