PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Eucgr.K02535.1.p
Common NameEUGRSUZ_K02535, LOC104426023
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family TCP
Protein Properties Length: 343aa    MW: 38224.1 Da    PI: 8.3527
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Eucgr.K02535.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP78.12.5e-2454121370
               TCP   3 gkkdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgtssssa 70 
                       g+kdrhsk+ T +g+RdRR+Rlsa+ a +++ Lqd LG+ ++sk i+WL+++a + i +l+ ++ ++ 
  Eucgr.K02535.1.p  54 GGKDRHSKVRTVRGLRDRRIRLSAPAAVQLYYLQDILGLTQPSKVIDWLIEAARHDIEKLPPLQIPQG 121
                       78***********************************************************9944433 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF036345.4E-2455121IPR005333Transcription factor, TCP
PROSITE profilePS5136925.32955113IPR017887Transcription factor TCP subgroup
Sequence ? help Back to Top
Protein Sequence    Length: 343 aa     Download sequence    Send to blast
MITSSREKKS AFQAKEVGEK GCSQISKVAP SSSSRWSLEL RNNPRVVRIP RTFGGKDRHS  60
KVRTVRGLRD RRIRLSAPAA VQLYYLQDIL GLTQPSKVID WLIEAARHDI EKLPPLQIPQ  120
GFSEVINQQL LFPPESINFF DASLPFTKHG LISPSLTLLA GSAKMEVNED CVWSADDRTR  180
LKSKYYWDGI SKLSERSNEF ERGCFSDKSK QIDLNVRENQ EDISSSGTGL VSDQNLLPIG  240
LLNNTIGYRH YIPGLNSEDQ FILSPSNMTG PSSIPSCSPC WTGAGPIDNE HRKVNHFPLF  300
NSGSQLPSFT PASLKLYYDA LETKYSLLSR DESQANDNNG NC*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5zkt_A2e-1360114155Putative transcription factor PCF6
5zkt_B2e-1360114155Putative transcription factor PCF6
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapEucgr.K02535.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010037245.10.0PREDICTED: transcription factor TCP5 isoform X3
TrEMBLA0A059A4B80.0A0A059A4B8_EUCGR; Uncharacterized protein
STRINGXP_010037244.10.0(Eucalyptus grandis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM3395122
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60970.14e-41TEOSINTE BRANCHED 1, cycloidea and PCF transcription factor 5