PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Eucgr.K01943.1.p
Common NameEUGRSUZ_K01943, LOC104425581
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family NF-YA
Protein Properties Length: 202aa    MW: 22235.6 Da    PI: 8.4304
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Eucgr.K01943.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA102.34.5e-32111167158
         CBFB_NFYA   1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 
                       +ep++VNaKQy++Il+RRq+Rak+e e+k   ksrkpylheSRh hAlrR+Rg+gGrF
  Eucgr.K01943.1.p 111 EEPVFVNAKQYHGILRRRQSRAKAELENKA-LKSRKPYLHESRHLHALRRARGCGGRF 167
                       69***************************9.9*************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005211.5E-35109170IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115237.399110170IPR001289Nuclear transcription factor Y subunit A
PfamPF020453.5E-27112167IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006162.0E-23113135IPR001289Nuclear transcription factor Y subunit A
PROSITE patternPS006860115135IPR018362CCAAT-binding factor, conserved site
PRINTSPR006162.0E-23144167IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0016602Cellular ComponentCCAAT-binding factor complex
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 202 aa     Download sequence    Send to blast
MTSSVHDISE NGEADEQQKH SEQHESSPAT GVPHPGVSLP NVQYATPPQL GAGHAMTPPA  60
YPYPDPYYRS IFAPYDAQSY PQQPYGAQPM VHLQLMGIQQ AGVPLPSDAV EEPVFVNAKQ  120
YHGILRRRQS RAKAELENKA LKSRKPYLHE SRHLHALRRA RGCGGRFLNA KKDENQQSEV  180
SSADKSQGNI NLNSDKSDRS S*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_A3e-20110175166NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapEucgr.K01943.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010036606.11e-148PREDICTED: nuclear transcription factor Y subunit A-7-like isoform X2
SwissprotQ84JP16e-70NFYA7_ARATH; Nuclear transcription factor Y subunit A-7
TrEMBLA0A059A2621e-148A0A059A262_EUCGR; Uncharacterized protein
STRINGVIT_10s0003g04650.t011e-114(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM41682756
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G30500.23e-61nuclear factor Y, subunit A7