PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Eucgr.K01921.1.p
Common NameEUGRSUZ_K01921, LOC104425566
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family NF-YA
Protein Properties Length: 316aa    MW: 35247.9 Da    PI: 9.9862
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Eucgr.K01921.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA77.13.5e-24151205258
         CBFB_NFYA   2 eplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 
                        p YVNaKQyqrIl R + Rak + e+    ++rkpy+h+SRh hA+rRpRgsgGrF
  Eucgr.K01921.1.p 151 GPRYVNAKQYQRILTRLKCRAKKKLENFG--RARKPYMHKSRHLHAMRRPRGSGGRF 205
                       79*********************997655..9************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005212.2E-24148208IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115227.749149208IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006162.2E-19152174IPR001289Nuclear transcription factor Y subunit A
PfamPF020451.7E-20152205IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006162.2E-19182205IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 316 aa     Download sequence    Send to blast
MTFKEHEMIH NNPNTQSSSL SFAPWLVLHG SQTPQSESVG RLNSVEHRAS EEFHPLSKKA  60
TQAVEGSADR PDMTQFAIFS EESKFSIDWR KPQLTMSALP EYGSNFHSEF GPPMMYSKYS  120
NVDQISGLFP LYGAQCQGRI MLPLNLTAED GPRYVNAKQY QRILTRLKCR AKKKLENFGR  180
ARKPYMHKSR HLHAMRRPRG SGGRFLNTKA LKNATEVNMK KTGSDGMSPC PTSPQSSEVL  240
QPESRGLNAS KVGDNNRTNL TGSEVASLYS PHRLLNNHVR PCVHPHLHVD NGGHDMVMPG  300
KWAPAADSCH DLKVV*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4g92_A5e-14150208262HAPB protein
4g91_A5e-14150208262HAPB protein
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapEucgr.K01921.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010036589.10.0PREDICTED: nuclear transcription factor Y subunit A-10-like isoform X1
TrEMBLA0A059A3060.0A0A059A306_EUCGR; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM30082767
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06510.24e-48nuclear factor Y, subunit A10