PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Eucgr.K01046.1.p
Common NameEUGRSUZ_K01046
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family SBP
Protein Properties Length: 237aa    MW: 26056.2 Da    PI: 8.3778
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Eucgr.K01046.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP133.56.9e-42117192277
                       -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S-- CS
               SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkq 77 
                       Cq+e+C+adl+ea++yhrrhkvCe+h+kap+v+v gl qrfCqqCsrfhel efDe+krsCrrrLa+hnerrrk+ 
  Eucgr.K01046.1.p 117 CQAEKCTADLTEARQYHRRHKVCEQHAKAPAVVVGGLYQRFCQQCSRFHELLEFDENKRSCRRRLAGHNERRRKNP 192
                       **************************************************************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.101.6E-32113178IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.129114191IPR004333Transcription factor, SBP-box
SuperFamilySSF1036123.27E-38116195IPR004333Transcription factor, SBP-box
PfamPF031101.2E-31117190IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 237 aa     Download sequence    Send to blast
MEKGKHRAFL EEKLKAEPAA ECEDGPGGGD GEDDDDSKRK KVPPSSGSRR GSGKSKIPVL  60
GTCCMQCVLR ACSSSSLASL EFNELYILDG SGFNEFSSFS FLCAADAPVL GAASRNCQAE  120
KCTADLTEAR QYHRRHKVCE QHAKAPAVVV GGLYQRFCQQ CSRFHELLEF DENKRSCRRR  180
LAGHNERRRK NPAEPHIEGS SGKAGGSTQM KELVCGQVDN RGRIQENATY KHFQIR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A2e-35115190984squamosa promoter binding protein-like 4
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00634PBMTransfer from PK22320.1Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapEucgr.K01046.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010035775.15e-94PREDICTED: squamosa promoter-binding protein 1-like
SwissprotQ9S7A96e-40SPL4_ARATH; Squamosa promoter-binding-like protein 4
TrEMBLA0A058ZZC21e-175A0A058ZZC2_EUCGR; Uncharacterized protein
STRINGVIT_12s0028g03350.t012e-61(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM86828118
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G53160.23e-41squamosa promoter binding protein-like 4