PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Eucgr.J02250.1.p
Common NameEUGRSUZ_J02250, LOC104422646
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family LBD
Protein Properties Length: 115aa    MW: 13425.4 Da    PI: 11.2656
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Eucgr.J02250.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF26097.61.3e-3017108192
            DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlka 92 
                       aCa C+v+++kC kdC  apyfpa ++++f ++h++FG + ++++l+++p+++r da++slvyeA+ar +dPv+G  g + ++  + e+l++
  Eucgr.J02250.1.p  17 ACARCRVMKKKCWKDCRWAPYFPAGEHERFTILHRVFGGNMIMEILQQVPNDRRADAIHSLVYEANARENDPVNGRRGQLAQMIAEEERLQV 108
                       7*****************************************************************************99999888888775 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.240.101.2E-5830IPR001138Zn(2)-C6 fungal-type DNA-binding domain
PROSITE profilePS5089119.9316114IPR004883Lateral organ boundaries, LOB
PfamPF031953.9E-2817107IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006357Biological Processregulation of transcription from RNA polymerase II promoter
GO:0005634Cellular Componentnucleus
GO:0000981Molecular FunctionRNA polymerase II transcription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 115 aa     Download sequence    Send to blast
MDGGGVRRRR RRRRRRACAR CRVMKKKCWK DCRWAPYFPA GEHERFTILH RVFGGNMIME  60
ILQQVPNDRR ADAIHSLVYE ANARENDPVN GRRGQLAQMI AEEERLQVPH QADG*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1715RRRRRRRRR
2815RRRRRRRR
3915RRRRRRR
4926RRRRRRRACARCRVMKKK
Cis-element ? help Back to Top
SourceLink
PlantRegMapEucgr.J02250.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010033333.17e-80PREDICTED: LOB domain-containing protein 12-like
TrEMBLA0A059AGU27e-80A0A059AGU2_EUCGR; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM3507622
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G30130.12e-24LBD family protein