PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Eucgr.J01038.1.p
Common NameEUGRSUZ_J01038, LOC104421755
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family NAC
Protein Properties Length: 539aa    MW: 60381.9 Da    PI: 4.3846
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Eucgr.J01038.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM174.62.8e-5491361128
               NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdke 91 
                       l+pGfrFhPtdeel+ +yLk+kv+gk+l++ ++i+evd+yk+ePwdLp k k+k+++ ewyfFs  dkky +g+++nrat++gyWk+tgkd++
  Eucgr.J01038.1.p   9 LAPGFRFHPTDEELIRYYLKRKVSGKPLRF-DAISEVDVYKCEPWDLPdKsKLKSRDLEWYFFSVLDKKYGNGSKTNRATENGYWKTTGKDRA 100
                       579*************************99.99**************95347777888*********************************** PP

               NAM  92 vlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                       +++  +++vg+kktLv+++grap+g++t+Wvmheyrl
  Eucgr.J01038.1.p 101 IYH-YSRTVGMKKTLVYHNGRAPRGQRTNWVMHEYRL 136
                       ***.999****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.18E-628159IPR003441NAC domain
PROSITE profilePS5100558.819159IPR003441NAC domain
PfamPF023657.9E-2811136IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009644Biological Processresponse to high light intensity
GO:0009962Biological Processregulation of flavonoid biosynthetic process
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
GO:0016021Cellular Componentintegral component of membrane
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 539 aa     Download sequence    Send to blast
MGRDKGKSLA PGFRFHPTDE ELIRYYLKRK VSGKPLRFDA ISEVDVYKCE PWDLPDKSKL  60
KSRDLEWYFF SVLDKKYGNG SKTNRATENG YWKTTGKDRA IYHYSRTVGM KKTLVYHNGR  120
APRGQRTNWV MHEYRLTDEE LEKAGIPQDA FVLCRIFQKS GSGPKNGEQY GAPFIEEEWE  180
DDDVALFPDQ EQMVVVHDEY VEADDLDQSI EVGTEPGDAP VPLNFYHGET SQGTEHSNDL  240
NEDEQKPLID TNAIQASLQQ QDEQFFVLPE QYRTEMKAIE NGYIGQSDDN ANPVDANYLL  300
DEPYLDVAGD DYYLQTNDLA NLLGEDAADF DVEDYLTFFD ADDENLLPYE SSQPPPENLL  360
SDHALHAEHI NGENEEAPLA GNLPSESCSK DCASTSKPHL DSKDPESSIK YPFMKAASQM  420
LGSFPAPPAF AAEFPVKDAA LRLNSAAQPS SSVHVTAGMI RIRNMNLVGS GMDWSIGKNG  480
ELNIVLSFGM SQADISPTDS GLRSRKTPSV ASWTWCFLFF WIILLSVGVK VGTSIYSR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A9e-48816514174Stress-induced transcription factor NAC1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator activated by proteolytic cleavage through regulated intramembrane proteolysis (RIP) (By similarity). Transcripition activator associated with the induction of genes related to flavonoid biosynthesis and required for the accumulation of anthocyanins in response to high light stress (PubMed:19887540). Plays a role in the regulation of 20S and 26S proteasomes in response to high light stress (PubMed:21889048). {ECO:0000250|UniProtKB:Q949N0, ECO:0000269|PubMed:19887540, ECO:0000269|PubMed:21889048}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00059PBMTransfer from AT5G04410Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapEucgr.J01038.1.p
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By exposure to high light (PubMed:19887540). Induced by heat and methyl methanesulfonate (MMS) treatment (PubMed:17158162). {ECO:0000269|PubMed:17158162, ECO:0000269|PubMed:19887540}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010032131.10.0PREDICTED: NAC domain-containing protein 78
SwissprotQ84K001e-169NAC78_ARATH; NAC domain-containing protein 78
TrEMBLA0A059ADS60.0A0A059ADS6_EUCGR; Uncharacterized protein
STRINGXP_010032131.10.0(Eucalyptus grandis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM31922762
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G04410.11e-164NAC domain containing protein 2
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  3. Liang M, et al.
    Subcellular Distribution of NTL Transcription Factors in Arabidopsis thaliana.
    Traffic, 2015. 16(10): p. 1062-74
    [PMID:26201836]
  4. Xiao D, et al.
    SENESCENCE-SUPPRESSED PROTEIN PHOSPHATASE Directly Interacts with the Cytoplasmic Domain of SENESCENCE-ASSOCIATED RECEPTOR-LIKE KINASE and Negatively Regulates Leaf Senescence in Arabidopsis.
    Plant Physiol., 2015. 169(2): p. 1275-91
    [PMID:26304848]
  5. Gladman NP,Marshall RS,Lee KH,Vierstra RD
    The Proteasome Stress Regulon Is Controlled by a Pair of NAC Transcription Factors in Arabidopsis.
    Plant Cell, 2016. 28(6): p. 1279-96
    [PMID:27194708]
  6. Tang Y,Zhao CY,Tan ST,Xue HW
    Arabidopsis Type II Phosphatidylinositol 4-Kinase PI4Kγ5 Regulates Auxin Biosynthesis and Leaf Margin Development through Interacting with Membrane-Bound Transcription Factor ANAC078.
    PLoS Genet., 2016. 12(8): p. e1006252
    [PMID:27529511]