PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Eucgr.J00764.1.p
Common NameEUGRSUZ_J00764
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family NF-YA
Protein Properties Length: 322aa    MW: 34719.9 Da    PI: 7.2923
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Eucgr.J00764.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA1025.7e-32162218158
         CBFB_NFYA   1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 
                       +ep+YVNaKQ+q+Il+RRq+Rak+e ekkl +k rkpylheSRh+hA+rR+Rg+gGrF
  Eucgr.J00764.1.p 162 QEPVYVNAKQFQGILRRRQARAKAELEKKL-IKVRKPYLHESRHQHAMRRARGTGGRF 218
                       69****************************.**************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005216.5E-35160221IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115236.408161221IPR001289Nuclear transcription factor Y subunit A
PfamPF020453.2E-28163218IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006161.3E-23164186IPR001289Nuclear transcription factor Y subunit A
PROSITE patternPS006860166186IPR018362CCAAT-binding factor, conserved site
PRINTSPR006161.3E-23195218IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010262Biological Processsomatic embryogenesis
GO:0048510Biological Processregulation of timing of transition from vegetative to reproductive phase
GO:0055046Biological Processmicrogametogenesis
GO:0016602Cellular ComponentCCAAT-binding factor complex
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 322 aa     Download sequence    Send to blast
MQPKSKISNG VDAHPHSIQT SAVFTEPADP GRNETHAPLG CINGGSESNG GQSQSNEERV  60
EEDDDDDNVK GSGNPACSGA VGNQGQGPQN GHGAPTIITM RDDGLAQPPQ LELVGHTIAC  120
ASNPYQDPYY GGLMAQYGHQ SMAYPFVGIP HARMPLPLDL AQEPVYVNAK QFQGILRRRQ  180
ARAKAELEKK LIKVRKPYLH ESRHQHAMRR ARGTGGRFAK KSETDASNDA AEEKGTNSGP  240
ALSSQSASSS GSEPLAPDSS ETWNSSSNHV AGRSQVHGTH RGHDYVNGNS QYKNHGHFQA  300
SAYSNERERD RFGQQPRERL L*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_A4e-19162226266NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapEucgr.J00764.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010031785.11e-164PREDICTED: nuclear transcription factor Y subunit A-1-like
RefseqXP_010031786.11e-164PREDICTED: nuclear transcription factor Y subunit A-1-like
RefseqXP_010031787.11e-164PREDICTED: nuclear transcription factor Y subunit A-1-like
SwissprotQ9LXV54e-71NFYA1_ARATH; Nuclear transcription factor Y subunit A-1
TrEMBLA0A059AAP60.0A0A059AAP6_EUCGR; Uncharacterized protein
STRINGGLYMA18G07890.21e-103(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM59462646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G12840.45e-65nuclear factor Y, subunit A1