PlantTFDB
Plant Transcription Factor Database
PlantRegMap/PlantTFDB v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Eucgr.J00574.1.p
Common NameEUGRSUZ_J00574, LOC104421354
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family TALE
Protein Properties Length: 694aa    MW: 75355.3 Da    PI: 8.9869
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Eucgr.J00574.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox277.6e-093924291954
                       HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
          Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                       Fe   ++yp+ +++  LAk+ gLt +qV++WF N R +
  Eucgr.J00574.1.p 392 FEHflHPYPKDSDKHMLAKQAGLTRSQVSNWFINARVR 429
                       554459******************************88 PP

2BELL1201.1e-38256326272
              BELL   2 rqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                       rqelq+kkakL+++l+eV++rYkqy+ q+q v+ssFe++ag+g ak+Yt+lAl++iSr+F+cLkdai++qi
  Eucgr.J00574.1.p 256 RQELQMKKAKLVDMLDEVEQRYKQYHSQMQLVVSSFEQAAGIGVAKSYTALALQTISRQFKCLKDAISSQI 326
                       89********************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005742.8E-60185324IPR006563POX domain
PfamPF075261.4E-47190323IPR006563POX domain
PROSITE profilePS5007112.098370433IPR001356Homeobox domain
CDDcd000861.98E-11373434No hitNo description
SMARTSM003896.6E-8373437IPR001356Homeobox domain
SuperFamilySSF466893.94E-16374440IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.606.8E-28376439IPR009057Homeodomain-like
PfamPF059202.0E-17390429IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 694 aa     Download sequence    Send to blast
MATYFHGSSE IEATDGLQTL YILNPNFIPY SNAAHDATAP NTLFLNPMGS ATQPAPSPQL  60
NHNHFVGIPL SGPAAPFGPA ASDVHPNRHE IPSLHSVAPR FRLNHPWGQP DTSAASTDQL  120
QICSATNSAG VSPSQRGLSL SLSTEQSPLS RESDIRGHSH RQFPGINEAR VLARNSSSTV  180
SNVVLGLHGV LLGSKYLKAA QELLDEVVNV GKEIKNHSSA EGANKEKSKL GNKDSSKEEK  240
KVESSSSGSE LGMAHRQELQ MKKAKLVDML DEVEQRYKQY HSQMQLVVSS FEQAAGIGVA  300
KSYTALALQT ISRQFKCLKD AISSQIKATG RSLGEDDCMG VKMEGSRLRY VDHHFQQQRA  360
LHQLGIIHQN NTWRPQRGLP ERAVSVLRAW LFEHFLHPYP KDSDKHMLAK QAGLTRSQVS  420
NWFINARVRL WKPMVEEMYL EETKSREQAG SENGTTRRAA TKSNKDAAGL KSASQEDNAF  480
GMNSSIKSFQ SSPNKALNQA AISPSENSNS TSSTSPMPCA IPPHHGFTLT GRSSNVEVGI  540
TSSPKKPRMS PDLMNPHGII LSRAMDMKGS EPSRELGGGG SDEYIHGGFS AFSMGNIDGR  600
YGNCVALTLG LPHRDQSPSL SVSAAPQNYF PNQSMNHHQL GRTKLVVGNG GEADFFGIAG  660
APQQSQSGSI NYEAIDINNR KRFADHLLPD YVA*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3k2a_A6e-16379437563Homeobox protein Meis2
3k2a_B6e-16379437563Homeobox protein Meis2
4xrs_A5e-16379436158Homeobox protein Meis1
4xrs_B5e-16379436158Homeobox protein Meis1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapEucgr.J00574.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010031566.10.0PREDICTED: BEL1-like homeodomain protein 1
TrEMBLA0A059AB490.0A0A059AB49_EUCGR; Uncharacterized protein
STRINGXP_010031566.10.0(Eucalyptus grandis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM50082650
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G35940.31e-116BEL1-like homeodomain 1