PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Eucgr.I01908.1.p
Common NameEUGRSUZ_I01908, LOC104420668
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family LBD
Protein Properties Length: 254aa    MW: 28281 Da    PI: 7.2601
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Eucgr.I01908.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260118.93e-37101101101
            DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkae 93 
                       aCa+Ck++rrkC k+C+lapyfpa+qpk f+n+h+lFG+sn++k+lk++p++ +++am+s+++e+++ra+ Pv+G++  i++l  ql+q+ +e
  Eucgr.I01908.1.p  10 ACAVCKFQRRKCHKECPLAPYFPADQPKMFQNAHRLFGVSNITKILKQAPPDLKQEAMQSVIFESNMRAQYPVHGCCWYIRRLLCQLHQVTEE 102
                       7******************************************************************************************** PP

            DUF260  94 lallkeel 101
                       l+++++++
  Eucgr.I01908.1.p 103 LQHVNTQI 110
                       **999875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089123.7739110IPR004883Lateral organ boundaries, LOB
PfamPF031953.8E-3510107IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009556Biological Processmicrosporogenesis
GO:0009786Biological Processregulation of asymmetric cell division
GO:0005634Cellular Componentnucleus
Sequence ? help Back to Top
Protein Sequence    Length: 254 aa     Download sequence    Send to blast
MTIKGGTSQA CAVCKFQRRK CHKECPLAPY FPADQPKMFQ NAHRLFGVSN ITKILKQAPP  60
DLKQEAMQSV IFESNMRAQY PVHGCCWYIR RLLCQLHQVT EELQHVNTQI AMCRDQVSAS  120
ASPSHYPPPP ELQLGNVHAD AVPTRQSFPG VFVNGESTKQ SIMSQQPYNY EPENTSHVGA  180
AQPNLASLPE LLMNYGADVF SYEDVPFDTI TIDKEESSTE SSFSFKNMTH SIEHASRNDL  240
KNAAAGFSLK SVR*
Cis-element ? help Back to Top
SourceLink
PlantRegMapEucgr.I01908.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010030769.10.0PREDICTED: LOB domain-containing protein 27-like
TrEMBLA0A059AQV50.0A0A059AQV5_EUCGR; Uncharacterized protein
STRINGPGSC0003DMT4000342882e-53(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM63032746
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G47870.12e-40LOB domain-containing protein 27