PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Eucgr.I01750.1.p
Common NameEUGRSUZ_I01750, LOC104419228
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family LBD
Protein Properties Length: 176aa    MW: 19096.3 Da    PI: 6.895
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Eucgr.I01750.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF2601413.8e-4410108199
            DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkae 93 
                       +CaaCk+lrrkC +dCv+apyfp e+p+kfanvhk+FGasnv+kll+++ +++reda++sl+yeAear++dPvyG+vg i+ lq+q+ +l++e
  Eucgr.I01750.1.p  10 PCAACKFLRRKCLPDCVFAPYFPPEEPQKFANVHKIFGASNVSKLLNEVLPHQREDAVNSLAYEAEARMKDPVYGCVGAISVLQRQVIRLQKE 102
                       7******************************************************************************************** PP

            DUF260  94 lallke 99 
                       l+++++
  Eucgr.I01750.1.p 103 LDATNA 108
                       *99876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089127.2769110IPR004883Lateral organ boundaries, LOB
PfamPF031951.5E-4310107IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 176 aa     Download sequence    Send to blast
MASSSYSNPP CAACKFLRRK CLPDCVFAPY FPPEEPQKFA NVHKIFGASN VSKLLNEVLP  60
HQREDAVNSL AYEAEARMKD PVYGCVGAIS VLQRQVIRLQ KELDATNADL MRHACNEMAG  120
NTSLPGPNPG HNYSGSPRES SRYNENNPGY YYPPNYNPWS GGPSGDPDQG GGSAV*
Cis-element ? help Back to Top
SourceLink
PlantRegMapEucgr.I01750.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010029135.11e-128PREDICTED: LOB domain-containing protein 25-like
SwissprotQ8L8Q38e-69LBD25_ARATH; LOB domain-containing protein 25
TrEMBLA0A059AQE91e-128A0A059AQE9_EUCGR; Uncharacterized protein
STRINGPOPTR_0001s35280.12e-81(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM13128340
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G27650.13e-70LOB domain-containing protein 25