PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Eucgr.H03425.1.p
Common NameEUGRSUZ_H03425
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family CPP
Protein Properties Length: 801aa    MW: 87950.7 Da    PI: 6.5782
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Eucgr.H03425.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR505.9e-16477514340
               TCR   3 kkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                       +k+CnCkkskClk+YCeCfaag++C e C C dC Nk 
  Eucgr.H03425.1.p 477 CKRCNCKKSKCLKLYCECFAAGVYCIEPCACLDCLNKP 514
                       89**********************************96 PP

2TCR50.54.1e-16561600140
               TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                       ++k+gCnCkks ClkkYCeC++ g+ Cs +C+Ce+CkN+ 
  Eucgr.H03425.1.p 561 RHKRGCNCKKSGCLKKYCECYQGGVGCSFNCRCEGCKNSF 600
                       589***********************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011145.5E-17475516IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163436.903476601IPR005172CRC domain
PfamPF036381.6E-11478513IPR005172CRC domain
SMARTSM011149.9E-17561602IPR033467Tesmin/TSO1-like CXC domain
PfamPF036381.4E-11563599IPR005172CRC domain
Sequence ? help Back to Top
Protein Sequence    Length: 801 aa     Download sequence    Send to blast
MDTPEKTQIA APPVSAHEDS PVFNFIRSLS PIKPVKSTHI AQTFTSLPFT ALPSVFTSPH  60
ANFHKDPSFL RRHQSLDPSN PDCSSENHNI VCRNGDFING ISQRSKSSDK KVSVEVHAEP  120
CKEHSDFATE FPQTSRCGFY NPEGNMTTCS AGAEAAVETA GMSTPIIPLA MKSSGKPLPE  180
GEGQQQKEWP IDASDLFIFS SPNDVEAFRE LVHRSPDFGT ACLSSLMSRF TPDDVSGFER  240
SQQVDLPSRE QQQIEPPYPT DEAYGQKEAI KNLDYHNLDK FLDKYMSIQL DKNSHNDAGT  300
CVPFDYTPVP NFHRGLRRRC LDFEIAELRK LSGDDSDYSH IALSQHDENT LVNDGQLPVE  360
SEGDPLRCTL PGIGLHLNAL ATTSNDYQSV EHGNLLSENQ LMNTQISSSS LNLPNSHQSL  420
HESLTSVASE DIGSADNGVL VVQDGSQSCA YPDSEELDHN SPQKKRRKAE HSEDMACKRC  480
NCKKSKCLKL YCECFAAGVY CIEPCACLDC LNKPIHEDTV LATRKQIESR NPLAFAPKVI  540
RASDSFPDTG DDSNKTPASA RHKRGCNCKK SGCLKKYCEC YQGGVGCSFN CRCEGCKNSF  600
GRKDGSTLNG VEAEIIDEGK ENIGKSMGNQ RSLEVAKQRD PIQATPSAYY GYHHVASLLL  660
INFHNDTKNT KWSSVCTRPS IQTTYSAKNE PLRSTSLVTT SSSSVLHAGQ NQGTHKHVAP  720
QPEFEKHYDD NNNNNNSNAG GKMPEVLRSN DTPNAVIKTA SPNGKRVSSP HSDFGSSPPL  780
RSGRRLILKS IPSFPSLTQH *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5fd3_A5e-1848059814120Protein lin-54 homolog
5fd3_B5e-1848059814120Protein lin-54 homolog
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1463467KKRRK
Cis-element ? help Back to Top
SourceLink
PlantRegMapEucgr.H03425.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010024233.10.0PREDICTED: protein tesmin/TSO1-like CXC 3
TrEMBLA0A059B4560.0A0A059B456_EUCGR; Uncharacterized protein
STRINGXP_010024233.10.0(Eucalyptus grandis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM14672891
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G22780.11e-125Tesmin/TSO1-like CXC domain-containing protein