PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Eucgr.G03121.1.p
Common NameEUGRSUZ_G03121, LOC104454449
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family LBD
Protein Properties Length: 224aa    MW: 24165.5 Da    PI: 8.9625
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Eucgr.G03121.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260135.51.9e-42451441100
            DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkae 93 
                       +CaaCk+lrr+Ca++C+++pyf  ++p+kfa vhk+FGasnv+k+l ++pe++r da++slvyeA++r+rdPvyG++g i++lqqq+++l+ae
  Eucgr.G03121.1.p  45 PCAACKLLRRRCAQECPFSPYFSPHEPQKFASVHKVFGASNVSKMLMEVPESQRADAANSLVYEANVRLRDPVYGCMGAISALQQQIQSLQAE 137
                       7******************************************************************************************** PP

            DUF260  94 lallkee 100
                       l+++++e
  Eucgr.G03121.1.p 138 LNAVRSE 144
                       ***9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.99244145IPR004883Lateral organ boundaries, LOB
PfamPF031952.0E-4245142IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
Sequence ? help Back to Top
Protein Sequence    Length: 224 aa     Download sequence    Send to blast
MSRESRERFD EIGKKIKRDG DASHHHLMGR RHMLGPPGTL NTITPCAACK LLRRRCAQEC  60
PFSPYFSPHE PQKFASVHKV FGASNVSKML MEVPESQRAD AANSLVYEAN VRLRDPVYGC  120
MGAISALQQQ IQSLQAELNA VRSEILKYKY REAGIISPTS HVTLLSPGTV SIAAPPPTPP  180
PQSAPTSLPP PLPPASSPPS LFTQPGGTTD YGGISSENVS YFG*
Cis-element ? help Back to Top
SourceLink
PlantRegMapEucgr.G03121.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010067591.11e-164PREDICTED: LOB domain-containing protein 15 isoform X1
SwissprotQ8L5T52e-89LBD15_ARATH; LOB domain-containing protein 15
TrEMBLA0A059BI151e-164A0A059BI15_EUCGR; Uncharacterized protein
STRINGVIT_13s0067g02380.t011e-115(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM19272781
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40470.13e-85LOB domain-containing protein 15