PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Eucgr.G03089.1.p
Common NameEUGRSUZ_G03089, LOC104454420
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family LBD
Protein Properties Length: 170aa    MW: 18685.4 Da    PI: 7.4659
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Eucgr.G03089.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260142.61.3e-4461051100
            DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkae 93 
                       +Ca+Ck+lrr+Cak+C++apyfp ++p++fa+vhk+FGasn++k+l++lp ++r da+sslvyeA+ar+rdPvyG+vg i+ lq+q++ql+ +
  Eucgr.G03089.1.p   6 PCASCKLLRRRCAKGCIFAPYFPPDDPHRFAIVHKVFGASNISKMLQELPVHQRADAVSSLVYEANARVRDPVYGCVGAISYLQNQVAQLQMQ 98 
                       7******************************************************************************************** PP

            DUF260  94 lallkee 100
                       la++++e
  Eucgr.G03089.1.p  99 LAVAQAE 105
                       ***9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.6915106IPR004883Lateral organ boundaries, LOB
PfamPF031954.3E-446103IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009965Biological Processleaf morphogenesis
Sequence ? help Back to Top
Protein Sequence    Length: 170 aa     Download sequence    Send to blast
MGGNSPCASC KLLRRRCAKG CIFAPYFPPD DPHRFAIVHK VFGASNISKM LQELPVHQRA  60
DAVSSLVYEA NARVRDPVYG CVGAISYLQN QVAQLQMQLA VAQAEILCIQ VQQEPVAMPS  120
PVVPMDSSDD KSFFLHNNLP QYFNLASNSS NVTHESLKRE SFFGHDMVS*
Cis-element ? help Back to Top
SourceLink
PlantRegMapEucgr.G03089.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010067560.11e-124PREDICTED: LOB domain-containing protein 12-like
SwissprotQ8LBW34e-75LBD12_ARATH; LOB domain-containing protein 12
TrEMBLA0A059BHX31e-123A0A059BHX3_EUCGR; Uncharacterized protein
STRINGVIT_13s0067g01880.t018e-96(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM13128340
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G30130.15e-63LBD family protein