PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Eucgr.F04424.1.p
Common NameEUGRSUZ_F04424, LOC104450999
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family LBD
Protein Properties Length: 163aa    MW: 17949.3 Da    PI: 8.2139
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Eucgr.F04424.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260146.11e-45131121100
            DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkae 93 
                       +CaaCk+lrr+Ca+dCv+apyfpa+qp+kfa+vhk+FGasnv k+l++l e++r+da+ss+vyeA+ar+rdPvyG+vg i++lqqq++ l+++
  Eucgr.F04424.1.p  13 PCAACKLLRRRCARDCVFAPYFPADQPQKFAIVHKVFGASNVNKMLQELLEHQRSDAVSSMVYEANARMRDPVYGCVGAISSLQQQVDVLQNQ 105
                       7******************************************************************************************** PP

            DUF260  94 lallkee 100
                       lal+++e
  Eucgr.F04424.1.p 106 LALAQAE 112
                       **99976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.55912113IPR004883Lateral organ boundaries, LOB
PfamPF031951.5E-4413110IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 163 aa     Download sequence    Send to blast
MKESGRKQGT LSPCAACKLL RRRCARDCVF APYFPADQPQ KFAIVHKVFG ASNVNKMLQE  60
LLEHQRSDAV SSMVYEANAR MRDPVYGCVG AISSLQQQVD VLQNQLALAQ AEVVHMRLQT  120
PQFPSTSSSA IAATNNDSSH SRRSYYPLNG VEQADVEDSL WS*
Cis-element ? help Back to Top
SourceLink
PlantRegMapEucgr.F04424.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010064042.11e-119PREDICTED: LOB domain-containing protein 4-like isoform X1
SwissprotQ9SHE92e-66LBD4_ARATH; LOB domain-containing protein 4
TrEMBLA0A059C0A21e-119A0A059C0A2_EUCGR; Uncharacterized protein
STRINGGLYMA08G17990.12e-79(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM13128340
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G31320.19e-44LOB domain-containing protein 4