PlantTFDB
Plant Transcription Factor Database
v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Eucgr.F03612.1.p
Common NameEUGRSUZ_F03612, LOC104450356
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family bZIP
Protein Properties Length: 301aa    MW: 32721.8 Da    PI: 4.419
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Eucgr.F03612.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_128.73e-09135176445
                       XCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
            bZIP_1   4 lkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaL 45 
                       +k++rr  +N+ AA rsR+RK+ +++eLe k+k +e+e ++L
  Eucgr.F03612.1.p 135 SKKQRRQLRNKDAAARSRERKRSYVKELEMKSKYMEGECRRL 176
                       79**********************************998776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1706.3E-11129193No hitNo description
SMARTSM003382.2E-5132196IPR004827Basic-leucine zipper domain
PROSITE profilePS502179.841134191IPR004827Basic-leucine zipper domain
PfamPF001702.9E-7136181IPR004827Basic-leucine zipper domain
SuperFamilySSF579592.81E-9136192No hitNo description
CDDcd147041.01E-14137188No hitNo description
PROSITE patternPS000360139154IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010200Biological Processresponse to chitin
GO:0030968Biological Processendoplasmic reticulum unfolded protein response
GO:0005634Cellular Componentnucleus
GO:0005789Cellular Componentendoplasmic reticulum membrane
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 301 aa     Download sequence    Send to blast
MENPDLPGDD LALEFDFQSL FDELSPDAAG LLDASDVDAS SPGSLSSWIG EIEGMLMKDD  60
EEAVAVEPSQ EVFDRFFAGL LVDSPEGGPA EATDGASDKE SNSSDGGGGG GERDEKLVVG  120
DNELSEDADD DDPVSKKQRR QLRNKDAAAR SRERKRSYVK ELEMKSKYME GECRRLGRLL  180
QCFVAENQAL RLNLENGGAY GATMAKQESA VLLLESLLLG SLLWFLGIMC LFTRPVSLQP  240
CPVAPPLENV GEKDLRSWAP RGIRGHAFEV SAAHSFAMTR RCRASRTKMK PCYLVPRALA  300
*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00019PBMTransfer from AT1G42990Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapEucgr.F03612.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKF0220062e-41KF022006.1 Jatropha curcas basic leucine zipper 60 (bZIP60) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010063178.10.0PREDICTED: bZIP transcription factor 60
TrEMBLA0A059BW840.0A0A059BW84_EUCGR; Uncharacterized protein
STRINGXP_010063178.10.0(Eucalyptus grandis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM46342848
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G42990.12e-28basic region/leucine zipper motif 60