PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Eucgr.F03303.1.p
Common NameEUGRSUZ_F03303, LOC104450119
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family SBP
Protein Properties Length: 187aa    MW: 21277.7 Da    PI: 8.6576
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Eucgr.F03303.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP131.82.3e-4166142177
                       --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S-- CS
               SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkq 77 
                       +Cq+e+C +dl++ak+yhrrhkvCevh+kapvv+v+gl+qrfCqqCsrfhel efDe+krsCrrrLa+hnerrrk++
  Eucgr.F03303.1.p  66 CCQAERCGTDLTDAKRYHRRHKVCEVHAKAPVVMVAGLRQRFCQQCSRFHELMEFDESKRSCRRRLAGHNERRRKSS 142
                       6**************************************************************************87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.103.1E-3460128IPR004333Transcription factor, SBP-box
SuperFamilySSF1036125.69E-3964146IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.65964141IPR004333Transcription factor, SBP-box
PfamPF031104.9E-3267140IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010321Biological Processregulation of vegetative phase change
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 187 aa     Download sequence    Send to blast
MINSKRFEGK KTLEDIIEDD MDDDVDEEEG HGNNEGEPFL HDDEKKKKGT NGKRGSSGSR  60
DASPPCCQAE RCGTDLTDAK RYHRRHKVCE VHAKAPVVMV AGLRQRFCQQ CSRFHELMEF  120
DESKRSCRRR LAGHNERRRK SSCEYYGEGS SRRMSGPQLK ECRPADSRGR GTAIPGNSTF  180
KHFQIR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A3e-3752140184squamosa promoter binding protein-like 4
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00359DAPTransfer from AT3G15270Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapEucgr.F03303.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010062855.11e-136PREDICTED: squamosa promoter-binding-like protein 3
SwissprotQ9S7584e-46SPL5_ARATH; Squamosa promoter-binding-like protein 5
TrEMBLA0A059BV681e-136A0A059BV68_EUCGR; Uncharacterized protein
STRINGPOPTR_0001s40870.12e-62(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM86828118
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G53160.23e-47squamosa promoter binding protein-like 4