PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Eucgr.F03236.1.p
Common NameEUGRSUZ_F03236, LOC104450071
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family BES1
Protein Properties Length: 321aa    MW: 34534.6 Da    PI: 8.7018
Description BES1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Eucgr.F03236.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF822189.61.2e-5821401149
            DUF822   1 ggsgrkptwkErEnnkrRERrRRaiaakiyaGLRaqGnyklpkraDnneVlkALcreAGwvvedDGttyrkgskpleeaeaagssasaspess 93 
                       +++ r+ptw+ErEnnkrRERrRRa+aaki++GLR++Gnyklpk++DnneVlkALc eAGw+ve+DGttyrkg+kp e+ +++ +s+++sp+ss
  Eucgr.F03236.1.p   2 TSGSRMPTWRERENNKRRERRRRAVAAKIFSGLRMYGNYKLPKHCDNNEVLKALCDEAGWIVEADGTTYRKGCKPVEHVDMVARSETVSPSSS 94 
                       5789***************************************************************************************** PP

            DUF822  94 lqsslkssalaspvesysaspksssfpspssldsislasa..asllpvlsvlslvsss 149
                       +             ++ ++sp sssfpsp+s+  + +a+a  + l+p+l++ s++sss
  Eucgr.F03236.1.p  95 YY------------PTHNPSPGSSSFPSPASSFYAANANAdgSFLIPWLKNFSSASSS 140
                       98............66777777788777766444433333348889999998886665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF056875.1E-584134IPR008540BES1/BZR1 plant transcription factor, N-terminal
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 321 aa     Download sequence    Send to blast
MTSGSRMPTW RERENNKRRE RRRRAVAAKI FSGLRMYGNY KLPKHCDNNE VLKALCDEAG  60
WIVEADGTTY RKGCKPVEHV DMVARSETVS PSSSYYPTHN PSPGSSSFPS PASSFYAANA  120
NADGSFLIPW LKNFSSASSS ASSSKLPHLY IPGSSISAPV TPHLSSPTAR SPRIKTGLDD  180
QSTRFGWGER YSFMPSSTPP SPGHQILPDP EWISRIQIPQ GGPVSPTFTL VSSNPFGSKQ  240
EVLAVGGSRT WTPGQSGTCS PAIAAAADHT GDIPMSEVMS NEFAFGVSGK GLVKPWEGER  300
IHDEPGSDDL ELTLGGSKCR *
Cis-element ? help Back to Top
SourceLink
PlantRegMapEucgr.F03236.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKP7214910.0KP721491.1 Eucalyptus grandis brassinazole-resistant 1 protein (BES4) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010062789.10.0PREDICTED: BES1/BZR1 homolog protein 4-like
SwissprotQ9ZV881e-118BEH4_ARATH; BES1/BZR1 homolog protein 4
TrEMBLA0A059BUW80.0A0A059BUW8_EUCGR; Uncharacterized protein
STRINGVIT_19s0014g00870.t011e-135(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM19172781
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G78700.11e-106BES1/BZR1 homolog 4