PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Eucgr.F03169.1.p
Common NameEUGRSUZ_F03169
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family NF-YA
Protein Properties Length: 259aa    MW: 29573.7 Da    PI: 9.4046
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Eucgr.F03169.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA102.44.1e-3299155158
         CBFB_NFYA   1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 
                       +ep+YVNaKQy++Il+RRq Rakl +e+kl +k rkpylheSRh+hA+rRpRgsgGrF
  Eucgr.F03169.1.p  99 EEPVYVNAKQYHGILRRRQYRAKLGAENKL-IKDRKPYLHESRHHHAVRRPRGSGGRF 155
                       69****************************.**************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005211.3E-3597158IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115236.22598158IPR001289Nuclear transcription factor Y subunit A
PfamPF020453.4E-27100155IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006161.0E-23101123IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006161.0E-23132155IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 259 aa     Download sequence    Send to blast
MSHLFFNLNA LWFQLCGLSN CGFHIDSDQF FVVFEWNSIK RKMELYLNTI SPTRDKASMC  60
LLCYALINYL PLKCPQISYP QMAGMIPSRL PLPFDTTQEE PVYVNAKQYH GILRRRQYRA  120
KLGAENKLIK DRKPYLHESR HHHAVRRPRG SGGRFLSKDQ KESKFTSLND ESNVKSTARV  180
SSAIDLPNSE VCQLKDHRDT GSTTSCSKTT QTTTSSDAIP VSKFRFFGQP WHVMTTCDPS  240
CDVRYSGDIR HLSLPGER*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_A5e-2399163266NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapEucgr.F03169.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010062677.11e-133PREDICTED: nuclear transcription factor Y subunit A-3 isoform X1
RefseqXP_010062679.11e-134PREDICTED: nuclear transcription factor Y subunit A-3 isoform X2
TrEMBLA0A059BV250.0A0A059BV25_EUCGR; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM33492762
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G72830.12e-41nuclear factor Y, subunit A3