PlantTFDB
Plant Transcription Factor Database
PlantRegMap/PlantTFDB v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Eucgr.F02193.1.p
Common NameEUGRSUZ_F02193
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family bZIP
Protein Properties Length: 121aa    MW: 13488 Da    PI: 10.6209
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Eucgr.F02193.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_1201.5e-063421655
                      HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
            bZIP_1 16 AArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkke 55
                      AA rsR+RKka++  Le k k Le++ ++L   l+    e
  Eucgr.F02193.1.p  3 AAVRSRERKKAYVRDLEVKGKYLEGKCRRLGRLLQCVMAE 42
                      99***********************998887666655555 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF579592.88E-6349No hitNo description
Gene3DG3DSA:1.20.5.1701.3E-6351No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0016021Cellular Componentintegral component of membrane
Sequence ? help Back to Top
Protein Sequence    Length: 121 aa     Download sequence    Send to blast
MNAAVRSRER KKAYVRDLEV KGKYLEGKCR RLGRLLQCVM AENQALRFSL ENNACGASVA  60
KQESAVLSDS LPLGSLFWFL CITCLFTLPL SLLLASEASR RYKASRTKMK AGFLLPRVWA  120
*
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor involved in endoplasmic reticulum (ER) stress response (PubMed:21223397, PubMed:22050533, PubMed:22199238). Acts downstream of the ER stress sensors IRE1, BZIP39 and BZIP60 to activate BiP chaperone genes (PubMed:22050533, PubMed:22199238). {ECO:0000269|PubMed:21223397, ECO:0000269|PubMed:22050533, ECO:0000269|PubMed:22199238}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapEucgr.F02193.1.p
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By dithiothreitol-induced endoplasmic reticulum (ER) stress response (PubMed:22050533, PubMed:21223397). Induced by salt stress (PubMed:22050533). {ECO:0000269|PubMed:21223397, ECO:0000269|PubMed:22050533}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010061241.11e-54PREDICTED: bZIP transcription factor 60
SwissprotQ69XV02e-26BZP50_ORYSJ; bZIP transcription factor 50
TrEMBLA0A059BR212e-80A0A059BR21_EUCGR; Uncharacterized protein
STRINGXP_010061241.15e-54(Eucalyptus grandis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM46342848
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G42990.11e-18basic region/leucine zipper motif 60
Publications ? help Back to Top
  1. Wakasa Y, et al.
    Expression of ER quality control-related genes in response to changes in BiP1 levels in developing rice endosperm.
    Plant J., 2011. 65(5): p. 675-89
    [PMID:21223397]
  2. Lu SJ, et al.
    Conservation of IRE1-regulated bZIP74 mRNA unconventional splicing in rice (Oryza sativa L.) involved in ER stress responses.
    Mol Plant, 2012. 5(2): p. 504-14
    [PMID:22199238]