PlantTFDB
Plant Transcription Factor Database
v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Eucgr.F01824.1.p
Common NameEUGRSUZ_F01824, LOC104448967
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family bZIP
Protein Properties Length: 305aa    MW: 32464.6 Da    PI: 4.544
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Eucgr.F01824.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_131.73.2e-10138188252
                       XXXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
            bZIP_1   2 kelkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleel 52 
                       +++k+ +r  +NR AA rsR+RKka ++ Le k+k Le+e ++L   l+  
  Eucgr.F01824.1.p 138 PASKKIKRQLRNRDAAVRSRERKKAFVKDLEVKSKYLEGECRRLGRLLQCV 188
                       689*************************************99887666555 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003384.4E-6137201IPR004827Basic-leucine zipper domain
PfamPF001701.2E-8139196IPR004827Basic-leucine zipper domain
PROSITE profilePS502179.645139196IPR004827Basic-leucine zipper domain
SuperFamilySSF579593.19E-10141199No hitNo description
Gene3DG3DSA:1.20.5.1703.0E-10141201No hitNo description
CDDcd147042.66E-15142193No hitNo description
PROSITE patternPS000360144159IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 305 aa     Download sequence    Send to blast
MEDLELHMED DDVMAHIDLD GFFGDIPDAG DVIGACSSAN GSSSSPDSGL SWFDEIENIL  60
MKDDEDGGVV GGGIRADSSQ EFCDRFLADV LVDSPGDGSA VIAGDGSGDK EEPGSSDDGG  120
VEAAKVDGAD GGGEAYDPAS KKIKRQLRNR DAAVRSRERK KAFVKDLEVK SKYLEGECRR  180
LGRLLQCVMA ENQALRFNLQ NSASGASVAK QESAVLSEPL PLGSLFWFLC ITCLFTLPPP  240
LLLALEAVLR ENSGKGNLKP LAAPRGARSE MFGSCGVQTL DKSRRYKALR TKMKAGFLLP  300
RVLA*
Cis-element ? help Back to Top
SourceLink
PlantRegMapEucgr.F01824.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010061241.10.0PREDICTED: bZIP transcription factor 60
TrEMBLA0A059BPY30.0A0A059BPY3_EUCGR; Uncharacterized protein
STRINGXP_010061241.10.0(Eucalyptus grandis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM46342848
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G42990.11e-17basic region/leucine zipper motif 60