PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Eucgr.E04355.1.p
Common NameEUGRSUZ_E02018, LOC104444675, LOC104445858
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family LBD
Protein Properties Length: 127aa    MW: 13951.8 Da    PI: 7.249
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Eucgr.E04355.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260135.61.9e-4215112198
            DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkae 93 
                       aCaaCk+lrr+C +dC +apyfpa++p+kf nvhk+FGasnv k+l++lpe++r +++sslvyeA+ar+rdPv+G+vg i++lq+ql+ + ae
  Eucgr.E04355.1.p  15 ACAACKLLRRRCMQDCLFAPYFPASEPHKFTNVHKVFGASNVNKMLQDLPEDQRANTVSSLVYEANARVRDPVNGCVGEITALQSQLADKIAE 107
                       7****************************************************************************************9999 PP

            DUF260  94 lallk 98 
                       +++l+
  Eucgr.E04355.1.p 108 VERLQ 112
                       98775 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.88814115IPR004883Lateral organ boundaries, LOB
PfamPF031952.3E-4115111IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 127 aa     Download sequence    Send to blast
MEESSEGRNR GTPLACAACK LLRRRCMQDC LFAPYFPASE PHKFTNVHKV FGASNVNKML  60
QDLPEDQRAN TVSSLVYEAN ARVRDPVNGC VGEITALQSQ LADKIAEVER LQVLLEAEKS  120
NRSPSS*
Cis-element ? help Back to Top
SourceLink
PlantRegMapEucgr.E04355.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010058105.14e-90PREDICTED: LOB domain-containing protein 4-like
RefseqXP_010056712.14e-90PREDICTED: LOB domain-containing protein 4-like
SwissprotQ9SHE97e-49LBD4_ARATH; LOB domain-containing protein 4
TrEMBLA0A059C5K55e-90A0A059C5K5_EUCGR; Uncharacterized protein
STRINGGLYMA20G02850.18e-52(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM13128340
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G31320.14e-50LOB domain-containing protein 4