PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Eucgr.E03593.1.p
Common NameEUGRSUZ_E03593, LOC104447391
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family GeBP
Protein Properties Length: 262aa    MW: 30070.7 Da    PI: 4.7884
Description GeBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Eucgr.E03593.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF57359.96.7e-1958149397
            DUF573   3 fqrlwseeDeivlLqGlidfkaktgkspsddidafyefvkksisfkvsksqlveKirrLKkKfkkkvkkaksgkepsfskehdqkifelskki 95 
                       +++ ws+ De+ lL+ l++f a+++ +p+ d+ ++y+f+++ ++  ++k+q+ +K+  LK K+++ v+    gk+++  ++++  ++ ls+k+
  Eucgr.E03593.1.p  58 MRKYWSKADELRLLRRLLEFSARKKENPVYDWGDIYKFISRDLETFYTKHQVRNKVYTLKSKYRDWVRL---GKKKQGMSPDELAAYRLSRKL 147
                       5788**************************************************************999...88888999************* PP

            DUF573  96 Wg 97 
                       W+
  Eucgr.E03593.1.p 148 WR 149
                       *7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF045042.6E-1860148IPR007592Protein of unknown function DUF573
Sequence ? help Back to Top
Protein Sequence    Length: 262 aa     Download sequence    Send to blast
MPASPALEDE ASEVTQAHEE DRDADPEEEP EEEEEDYDEE ETAKSRDGTR AKKGPDLMRK  60
YWSKADELRL LRRLLEFSAR KKENPVYDWG DIYKFISRDL ETFYTKHQVR NKVYTLKSKY  120
RDWVRLGKKK QGMSPDELAA YRLSRKLWRD EVKGESSGRS NGDGKAERGD RTALAALKAE  180
LLVFDRMPEG MGSGFLSEVK RFGAVGVDEE FLRAGLGLIE REKRAELEER WRKLQMAELA  240
ALAERAELIG LVAEAILEAY E*
Cis-element ? help Back to Top
SourceLink
PlantRegMapEucgr.E03593.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010059432.10.0PREDICTED: uncharacterized protein LOC104447391
TrEMBLA0A059CAA20.0A0A059CAA2_EUCGR; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM31328181
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G25650.15e-07DNA-binding storekeeper protein-related transcriptional regulator