PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Eucgr.E03260.1.p
Common NameEUGRSUZ_E03260, LOC104445258
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family SBP
Protein Properties Length: 148aa    MW: 16977.5 Da    PI: 6.3574
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Eucgr.E03260.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP133.28.8e-4263138277
                       -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S-- CS
               SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkq 77 
                       Cq+e+C++d+++ak+yhrrhkvCe+h+ka+v++v+gl+qrfCqqCsrfhelsefDe+krsCrrrLa+hnerrrk++
  Eucgr.E03260.1.p  63 CQAENCSVDMTDAKRYHRRHKVCEFHAKASVAMVAGLRQRFCQQCSRFHELSEFDETKRSCRRRLAGHNERRRKSS 138
                       **************************************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0375752.2E-567147IPR017238Squamosa promoter-binding protein
Gene3DG3DSA:4.10.1100.101.8E-3359124IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.20660137IPR004333Transcription factor, SBP-box
SuperFamilySSF1036121.96E-3961141IPR004333Transcription factor, SBP-box
PfamPF031102.6E-3163136IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009908Biological Processflower development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046872Molecular Functionmetal ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 148 aa     Download sequence    Send to blast
MESPNFGEDE RSLKDNKMED EDLEEEEEDE DESSEADRKR ARAATRSTRK GGSCSGWAPP  60
PLCQAENCSV DMTDAKRYHR RHKVCEFHAK ASVAMVAGLR QRFCQQCSRF HELSEFDETK  120
RSCRRRLAGH NERRRKSSYD NQGEGSN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A9e-3855136384squamosa promoter binding protein-like 4
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapEucgr.E03260.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHQ4503890.0HQ450389.1 Eucalyptus globulus SPL3-like protein (SPL3) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010057392.11e-105PREDICTED: squamosa promoter-binding-like protein 3
SwissprotQ387413e-46SBP1_ANTMA; Squamosa promoter-binding protein 1
TrEMBLA0A059C8J51e-105A0A059C8J5_EUCGR; Squamosa promoter-binding-like protein
STRINGPOPTR_0001s40870.12e-48(Populus trichocarpa)
STRINGPOPTR_0004s04630.19e-49(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM86828118
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G15270.13e-45squamosa promoter binding protein-like 5