PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Eucgr.E02410.1.p
Common NameEUGRSUZ_E02410
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family LBD
Protein Properties Length: 117aa    MW: 12430.3 Da    PI: 7.0817
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Eucgr.E02410.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260116.81.3e-3638117180
            DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvi 80 
                       +CaaCk+lrr+C+++Cvlapyfp ++p+kfa++h++FGasn++k+l +lpe++r+da++s++yeA  r+rdPvyG++g i
  Eucgr.E02410.1.p  38 PCAACKTLRRRCSESCVLAPYFPPSEPAKFAIAHRVFGASNIVKFLLTLPESQRDDAVTSMIYEASTRIRDPVYGCAGAI 117
                       7****************************************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089124.29237117IPR004883Lateral organ boundaries, LOB
PfamPF031954.9E-3638117IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 117 aa     Download sequence    Send to blast
MESSDTGAFE SSPPSSLVPP SWSSPTPALP LPVVVASPCA ACKTLRRRCS ESCVLAPYFP  60
PSEPAKFAIA HRVFGASNIV KFLLTLPESQ RDDAVTSMIY EASTRIRDPV YGCAGAI
Cis-element ? help Back to Top
SourceLink
PlantRegMapEucgr.E02410.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010056894.14e-80PREDICTED: LOB domain-containing protein 1-like
SwissprotQ9LQR01e-48LBD1_ARATH; LOB domain-containing protein 1
TrEMBLA0A059C5R12e-79A0A059C5R1_EUCGR; Uncharacterized protein (Fragment)
STRINGGLYMA12G07650.12e-47(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM13128340
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07900.11e-43LOB domain-containing protein 1