PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Eucgr.E02056.1.p
Common NameEUGRSUZ_E02056
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family LBD
Protein Properties Length: 71aa    MW: 7648.8 Da    PI: 8.2286
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Eucgr.E02056.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF26054.14.6e-171562148
            DUF260  1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllka 48
                      +C  Ck+ +r+Ca+dCv+ap  pa++p+kfanvh++FGasnv k+ + 
  Eucgr.E02056.1.p 15 PCTLCKLPQRRCAQDCVFAPNCPADEPHKFANVHEVFGASNVNKMFQV 62
                      7********************************************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089114.6131470IPR004883Lateral organ boundaries, LOB
PfamPF031955.5E-161561IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 71 aa     Download sequence    Send to blast
MKESGGGWKQ GMPSPCTLCK LPQRRCAQDC VFAPNCPADE PHKFANVHEV FGASNVNKMF  60
QVTHLISSSV *
Cis-element ? help Back to Top
SourceLink
PlantRegMapEucgr.E02056.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010058727.14e-40PREDICTED: B3 domain-containing protein At2g33720-like
SwissprotQ9SHE94e-25LBD4_ARATH; LOB domain-containing protein 4
TrEMBLA0A059C5B22e-47A0A059C5B2_EUCGR; Uncharacterized protein
STRINGGLYMA07G35000.17e-26(Glycine max)
STRINGGLYMA09G02510.19e-26(Glycine max)
STRINGGLYMA15G13410.17e-26(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM122821432
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G31320.13e-26LOB domain-containing protein 4