PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Eucgr.E01736.1.p
Common NameEUGRSUZ_E01736, LOC104444521
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family MIKC_MADS
Protein Properties Length: 241aa    MW: 27160.1 Da    PI: 9.2295
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Eucgr.E01736.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF54.61.4e-171151343
                      --SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TT CS
            SRF-TF  3 ienksnrqvtfskRrngilKKAeELSvLCdaevaviifsst 43
                      i n+  r+ tf kR+ng++KK +ELS+LC++e++ i++s+ 
  Eucgr.E01736.1.p 11 IANDAARKATFKKRKNGLMKKVSELSTLCGIEACAIVYSQY 51
                      899************************************85 PP

2K-box14.71.3e-061101722789
             K-box  27 eienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqe 89 
                       e e  q   R l+Ge+L+ L++ +L+ L   L+k  k+i ++ ++l ++  +  q    elq 
  Eucgr.E01736.1.p 110 EREIVQVMYRVLVGEGLQGLTIVDLNDLGWMLDKTGKEIEERIKKLKKSAPSSEQAASAELQA 172
                       44667888899*******************************999988877777777777765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF554551.05E-22185IPR002100Transcription factor, MADS-box
SMARTSM004324.9E-23160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006616.708150IPR002100Transcription factor, MADS-box
CDDcd002663.35E-29285No hitNo description
PRINTSPR004045.1E-9323IPR002100Transcription factor, MADS-box
PfamPF003194.7E-181150IPR002100Transcription factor, MADS-box
PRINTSPR004045.1E-92338IPR002100Transcription factor, MADS-box
PRINTSPR004045.1E-93859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 241 aa     Download sequence    Send to blast
MTRKKAALAY IANDAARKAT FKKRKNGLMK KVSELSTLCG IEACAIVYSQ YQAEPEVWPS  60
TLGARRAIAR FKNMSEMDQS KRMVNQQEFI RQRIVKAEEQ LKKQLHENRE REIVQVMYRV  120
LVGEGLQGLT IVDLNDLGWM LDKTGKEIEE RIKKLKKSAP SSEQAASAEL QADKAAPENH  180
AALNDVVAVE GLEATQNQPW YMDLLKPRNE GDALNLGRND PMPSYPYGNP APSWSDFYFP  240
*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1224RKKAALAYIANDAARKATFKKRK
Cis-element ? help Back to Top
SourceLink
PlantRegMapEucgr.E01736.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010056504.11e-180PREDICTED: agamous-like MADS-box protein AGL80
TrEMBLA0A059C5011e-178A0A059C501_EUCGR; Uncharacterized protein
STRINGXP_010056504.11e-179(Eucalyptus grandis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM7028415
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G48670.13e-50AGAMOUS-like 80