PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Eucgr.E01734.1.p
Common NameEUGRSUZ_E01734, LOC104446416
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family M-type_MADS
Protein Properties Length: 238aa    MW: 26916.8 Da    PI: 9.2301
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Eucgr.E01734.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF54.12e-171151343
                      --SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TT CS
            SRF-TF  3 ienksnrqvtfskRrngilKKAeELSvLCdaevaviifsst 43
                      i n+  r+ tf kR+ng++KK +ELS+LC+++++ i++ss 
  Eucgr.E01734.1.p 11 IANDAARKATFKKRKNGLMKKVSELSTLCGIDACAIVYSSY 51
                      899************************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006617.1150IPR002100Transcription factor, MADS-box
SMARTSM004323.4E-24160IPR002100Transcription factor, MADS-box
SuperFamilySSF554557.98E-24185IPR002100Transcription factor, MADS-box
CDDcd002665.68E-30285No hitNo description
PRINTSPR004041.0E-9323IPR002100Transcription factor, MADS-box
PfamPF003193.5E-181150IPR002100Transcription factor, MADS-box
PRINTSPR004041.0E-92338IPR002100Transcription factor, MADS-box
PRINTSPR004041.0E-93859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0043078Cellular Componentpolar nucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 238 aa     Download sequence    Send to blast
MTRKKVTLAY IANDAARKAT FKKRKNGLMK KVSELSTLCG IDACAIVYSS YQAEPEVWPS  60
TLGVHRAIAR FKNMSEMDQS KRMVNQQEFI RQRIVKAEEQ LKKQLHENRE REIVQVMYRA  120
LVGEGLQGLI IVDLNDLGWM LDKTGKEIEE RIKKLKKSTP SSEQAASAEL QADKAAPENH  180
AALNDVVAVE ATQNQPWYMD LLKPRNEGDA LNLGRNDPMP SYPYGNPTPS WSDFYFP*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1224RKKVTLAYIANDAARKATFKKRK
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. Controls central cell differentiation during female gametophyte development. Required for the expression of DEMETER and DD46, but not for the expression of FIS2 (PubMed:16798889). Probable transcription factor that may function in the maintenance of the proper function of the central cell in pollen tube attraction (Probable). {ECO:0000269|PubMed:16798889, ECO:0000305|PubMed:26462908}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00553DAPTransfer from AT5G48670Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapEucgr.E01734.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010058574.11e-178PREDICTED: agamous-like MADS-box protein AGL80
SwissprotQ9FJK34e-53AGL80_ARATH; Agamous-like MADS-box protein AGL80
TrEMBLA0A059C5R31e-177A0A059C5R3_EUCGR; Uncharacterized protein
STRINGXP_010058574.11e-178(Eucalyptus grandis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM7028415
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G48670.16e-51AGAMOUS-like 80
Publications ? help Back to Top
  1. Zhang S, et al.
    FERTILIZATION-INDEPENDENT SEED-Polycomb Repressive Complex 2 Plays a Dual Role in Regulating Type I MADS-Box Genes in Early Endosperm Development.
    Plant Physiol., 2018. 177(1): p. 285-299
    [PMID:29523711]