PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Eucgr.E00246.1.p
Common NameEUGRSUZ_E00246
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family G2-like
Protein Properties Length: 347aa    MW: 38620.8 Da    PI: 9.4616
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Eucgr.E00246.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like102.23.3e-32214267255
           G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                       pr+rWt++LH+rFv+ave LGG+e+AtPk++lelm+vk+Ltl+hvkSHLQ+YR+
  Eucgr.E00246.1.p 214 PRMRWTTTLHARFVHAVELLGGHERATPKSVLELMDVKDLTLAHVKSHLQMYRT 267
                       9****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.79E-15211267IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.5E-28212267IPR009057Homeodomain-like
TIGRFAMsTIGR015572.1E-23214267IPR006447Myb domain, plants
PfamPF002492.2E-7215266IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 347 aa     Download sequence    Send to blast
MEIFPAQPDL SLQISPPNAK SASWRRTAEE DVNLGFWKRA LDSRSHHSLP SSMAAKNDAR  60
FDLSLSNPRA GHNAVGGNTI PEANNNVSYN HLHQGGNHIH SFQNQSQYSD SNHHQHMHQH  120
HHSVLQHQPQ GLSQELGFLR PIRGIPVYHQ NSSSAFPFAT QLQHLDPSPI HHPNSSNSLT  180
NSANSIASNL CHSHGLVRSR FLSRFPAKRG MRAPRMRWTT TLHARFVHAV ELLGGHERAT  240
PKSVLELMDV KDLTLAHVKS HLQMYRTVKT TDRAAANSSG QTDVFDNGSS GETSDDLVIE  300
VANPKRPELG RHDHQDTNQH GLWSNSSISS IYICQRSHSR SIMMDS*
Cis-element ? help Back to Top
SourceLink
PlantRegMapEucgr.E00246.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010055276.10.0PREDICTED: probable transcription factor KAN2
TrEMBLA0A059BZU00.0A0A059BZU0_EUCGR; Uncharacterized protein
STRINGPOPTR_0001s02010.11e-112(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM53872850
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G32240.15e-57G2-like family protein