PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Eucgr.D02225.1.p
Common NameEUGRSUZ_D02225, LOC104442045
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family G2-like
Protein Properties Length: 376aa    MW: 41990.8 Da    PI: 9.8384
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Eucgr.D02225.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like1023.8e-32193246255
           G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                       pr+rWt++LH+rFv+ave LGG+e+AtPk++lelm+vk+Ltl+hvkSHLQ+YR+
  Eucgr.D02225.1.p 193 PRMRWTTTLHARFVHAVELLGGHERATPKSVLELMDVKDLTLAHVKSHLQMYRT 246
                       9****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.3E-28190246IPR009057Homeodomain-like
SuperFamilySSF466892.51E-15190246IPR009057Homeodomain-like
TIGRFAMsTIGR015572.4E-23193246IPR006447Myb domain, plants
PfamPF002492.4E-7194245IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 376 aa     Download sequence    Send to blast
MRMELFPAQP DLSLQISPPN SKPTSAWRRS TDQEEANLSF WKKALDSRSS LSSMSKPDTR  60
PELSPSSTTL FTGSGPDTHP LLQKRGSNSL VHRFQEKNHK TVYQQHLQHN PLGQEVETLR  120
PIRGIPLYQN TSFPFSHHQQ QQPLEVIANS SLSSLANNAA MSRSSSNRFH SHGLMRSRLA  180
SRFPGPKRST RAPRMRWTTT LHARFVHAVE LLGGHERATP KSVLELMDVK DLTLAHVKSH  240
LQMYRTVKTT DKTAASSGQS EVLDNASSGD TSEDLVFEIG NSRGPETSIQ QGELNNQEKD  300
YYALKWSKSA REAWKQGKLP EDDFIGNCAT YVEEDRNAKC PSNERISDVN SPNLSGTSNN  360
MKPNLEFTLG RSSSH*
Cis-element ? help Back to Top
SourceLink
PlantRegMapEucgr.D02225.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010053635.10.0PREDICTED: probable transcription factor KAN2
SwissprotQ9C6163e-83KAN2_ARATH; Probable transcription factor KAN2
TrEMBLA0A059CIK10.0A0A059CIK1_EUCGR; Uncharacterized protein
STRINGVIT_02s0012g01940.t011e-130(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM53872850
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G32240.15e-78G2-like family protein