PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Eucgr.D00428.1.p
Common NameBES3, EUGRSUZ_D00428, LOC104440868
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family BES1
Protein Properties Length: 321aa    MW: 34326.2 Da    PI: 9.0239
Description BES1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Eucgr.D00428.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF822213.35.8e-6621461149
            DUF822   1 ggsgrkptwkErEnnkrRERrRRaiaakiyaGLRaqGnyklpkraDnneVlkALcreAGwvvedDGttyrkgskpleeaeaagssasaspess 93 
                       ++++r+ptwkErEnnkrRERrRRaiaaki+aGLR++Gnyklpk++DnneVlkALc+eAGw+ve+DGttyrkg++ple+++++g s+sasp+ss
  Eucgr.D00428.1.p   2 TSGTRTPTWKERENNKRRERRRRAIAAKIFAGLRMYGNYKLPKHCDNNEVLKALCKEAGWTVEEDGTTYRKGCRPLERMDIMGGSTSASPCSS 94 
                       5899***************************************************************************************** PP

            DUF822  94 lqsslkssalaspvesysaspksssfpspssldsislasa....asllpvlsvlslvsss 149
                       ++        +sp++sy++sp+sssfpsp+++    + +      sl+p+l++ls+ sss
  Eucgr.D00428.1.p  95 YH--------PSPCASYNPSPASSSFPSPARSPYPGHPHGnpdaDSLIPWLKNLSSGSSS 146
                       **........*******************9988776654456779*********997666 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF056871.7E-653141IPR008540BES1/BZR1 plant transcription factor, N-terminal
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 321 aa     Download sequence    Send to blast
MTSGTRTPTW KERENNKRRE RRRRAIAAKI FAGLRMYGNY KLPKHCDNNE VLKALCKEAG  60
WTVEEDGTTY RKGCRPLERM DIMGGSTSAS PCSSYHPSPC ASYNPSPASS SFPSPARSPY  120
PGHPHGNPDA DSLIPWLKNL SSGSSSASSK LPHHLFIPGG SISAPVTPPL SSPTSRTPRA  180
KNHWDHVAAS MTWTGQHNSV FPSSTPPSPG RQVLPDSGWL TGGPSSPTFS LVARNPFGFK  240
EEAFSGGGSR MWTPGQSGTC SPAIAAGADL TSDIPMSDSM ATEFAFGSNA TGLVKPWEGE  300
RIHEDASDDL ELTLGNARTR *
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00248DAPTransfer from AT1G78700Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapEucgr.D00428.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKP7214900.0KP721490.1 Eucalyptus grandis brassinazole-resistant 1 protein (BES3) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010052158.10.0PREDICTED: BES1/BZR1 homolog protein 4 isoform X2
RefseqXP_010052157.10.0PREDICTED: BES1/BZR1 homolog protein 4 isoform X1
SwissprotQ9ZV881e-133BEH4_ARATH; BES1/BZR1 homolog protein 4
TrEMBLA0A059CDQ10.0A0A059CDQ1_EUCGR; Brassinazole-resistant 1 protein
STRINGPOPTR_0004s06100.11e-149(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM19172781
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G78700.11e-104BES1/BZR1 homolog 4