PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Eucgr.C02545.1.p
Common NameEUGRSUZ_C02545, LOC104437527
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family WRKY
Protein Properties Length: 484aa    MW: 50373.2 Da    PI: 9.195
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Eucgr.C02545.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY77.61.4e-24173228359
                       -SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
              WRKY   3 DgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                       DgynWrKYGqK+vk+ + +rsY+rCt ++C++kk +e+++e ++++e++Y+++Hnh+
  Eucgr.C02545.1.p 173 DGYNWRKYGQKQVKSPKGSRSYFRCTNTECSAKK-IECCDEIGHMLETVYRSQHNHD 228
                       9*******************************98.*********************7 PP

2WRKY98.73.6e-31345402259
                       --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
              WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                        Dgy+WrKYGqK+vkg+++pr+YYrCtsagCpv+k++e++ ++ ++v+itY+g H+h+
  Eucgr.C02545.1.p 345 ADGYRWRKYGQKMVKGNPHPRNYYRCTSAGCPVRKQIETAVDNANAVIITYKGVHDHD 402
                       6********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.802.0E-20171230IPR003657WRKY domain
SMARTSM007742.0E-24171229IPR003657WRKY domain
SuperFamilySSF1182909.42E-19172230IPR003657WRKY domain
PfamPF031066.0E-18173228IPR003657WRKY domain
PROSITE profilePS5081117.305173230IPR003657WRKY domain
Gene3DG3DSA:2.20.25.803.9E-32330404IPR003657WRKY domain
PROSITE profilePS5081131.433339404IPR003657WRKY domain
SuperFamilySSF1182903.14E-27340404IPR003657WRKY domain
SMARTSM007745.5E-36344403IPR003657WRKY domain
PfamPF031065.1E-24346401IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 484 aa     Download sequence    Send to blast
MAGEGGASSG ALEAGGGRPG ELPSSAGGGG SGGGGAGSGA GSGTGGGPPS ETLGAAASDC  60
DRGEGSKASS TAAEESKVIK EQVQQSHQEG LAVGAGKTIQ TETQIQLRLS PCAMATSELS  120
PTSVTQSISS IPSPTPVEQG SGMKITGSCM PDPHIRSSYT RNAPRALRTS NIDGYNWRKY  180
GQKQVKSPKG SRSYFRCTNT ECSAKKIECC DEIGHMLETV YRSQHNHDPP KKANGMLEGK  240
FEKSVGSVDK HLSNNHSARV LDDSVPSSSS KEPAQEIPAR TKSEHQNSVG FHGKGETTVK  300
NEHVNEIEHR QSGKKNKSCH SDPPPKPGKK AKIVVHAAGD VGISADGYRW RKYGQKMVKG  360
NPHPRNYYRC TSAGCPVRKQ IETAVDNANA VIITYKGVHD HDMPVPKKRH GPPSAPLVAA  420
AAPASMSSAP HKKVDAAQNG KASTKLSVDA GGELTGEAME LGGEKAMESA RTLLSIGIEI  480
KPC*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2ayd_A9e-26331404174WRKY transcription factor 1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapEucgr.C02545.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010048803.10.0PREDICTED: probable WRKY transcription factor 32 isoform X1
SwissprotP595831e-110WRK32_ARATH; Probable WRKY transcription factor 32
TrEMBLA0A059CRS30.0A0A059CRS3_EUCGR; Uncharacterized protein
STRINGGLYMA02G36510.11e-157(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM63382844
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G30935.18e-99WRKY DNA-binding protein 32