PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Eucgr.C02487.1.p
Common NameEUGRSUZ_C02487
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family WRKY
Protein Properties Length: 127aa    MW: 12998.2 Da    PI: 8.5126
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Eucgr.C02487.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY29.41.7e-0916453059
                      TT---EEEEEE-SSSTTEEEEEEES--SS- CS
              WRKY 30 agCpvkkkversaedpkvveitYegeHnhe 59
                      agCpv+k++e++ ++ ++v+itY+g H+h+
  Eucgr.C02487.1.p 16 AGCPVRKQIETAVDNANAVIITYKGVHDHD 45
                      58***************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5081112.438647IPR003657WRKY domain
SuperFamilySSF1182902.62E-71647IPR003657WRKY domain
SMARTSM007740.00411646IPR003657WRKY domain
Gene3DG3DSA:2.20.25.802.8E-81647IPR003657WRKY domain
PfamPF031063.4E-51744IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 127 aa     Download sequence    Send to blast
MVVVACVHGV ALLVLAGCPV RKQIETAVDN ANAVIITYKG VHDHDMPVPK KRHRPPSAPL  60
VAAAAPASMS SAPHKKVDAA QNGKASTKLS VDAGGELTGE VMELGGEKAM ESARTLLSIG  120
IEIKPC*
Cis-element ? help Back to Top
SourceLink
PlantRegMapEucgr.C02487.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010048804.12e-69PREDICTED: probable WRKY transcription factor 32 isoform X2
SwissprotP595834e-38WRK32_ARATH; Probable WRKY transcription factor 32
TrEMBLA0A059CRK82e-86A0A059CRK8_EUCGR; Uncharacterized protein
STRINGPGSC0003DMT4000290691e-49(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM63382844
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G30935.15e-29WRKY DNA-binding protein 32