PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Eucgr.C02481.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family WRKY
Protein Properties Length: 547aa    MW: 57051 Da    PI: 9.1947
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Eucgr.C02481.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY76.92.4e-24236291359
                       -SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
              WRKY   3 DgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                       Dgy+WrKYGqK+vk+ + +rsY+rCt ++C++kk +e ++e ++++e++Y+++Hnh+
  Eucgr.C02481.1.p 236 DGYSWRKYGQKQVKSPKGSRSYFRCTNTECSAKK-IEICDELGHMLETVYRSQHNHD 291
                       9*******************************98.*********************7 PP

2WRKY96.71.6e-30408465259
                       --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
              WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                        Dgy+WrKYGqK+vkg++ pr+YYrCtsagCpv+k++e++ ++ ++v itY+g H+h+
  Eucgr.C02481.1.p 408 ADGYRWRKYGQKMVKGNPRPRNYYRCTSAGCPVRKQIETAVDNANAVLITYKGVHDHD 465
                       6********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.801.2E-20234293IPR003657WRKY domain
SMARTSM007741.8E-24234292IPR003657WRKY domain
SuperFamilySSF1182906.02E-19235293IPR003657WRKY domain
PfamPF031063.1E-18236291IPR003657WRKY domain
PROSITE profilePS5081117.442236293IPR003657WRKY domain
Gene3DG3DSA:2.20.25.801.2E-30393467IPR003657WRKY domain
PROSITE profilePS5081130.917402467IPR003657WRKY domain
SuperFamilySSF1182902.48E-26403467IPR003657WRKY domain
SMARTSM007743.7E-34407466IPR003657WRKY domain
PfamPF031065.6E-23409464IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 547 aa     Download sequence    Send to blast
MTPVWIFPRR SASCTSPSDR RESPESVRGF EVLLSPCLSV SLSSRRVQCC GCCWCAAGGG  60
GGGRREPVMA GAGGASSGAL EAGGGRPGEL PSSAGGGGGG GGAGSGTGGG PPSETLGAAA  120
SDCDRGEGSK ASSPAAEESK VIKEQVQQSH QEGLAVGAGE TIQTQTQIQL RLSPCAMATS  180
ELSPTSVTQS ISSIPSPTPV EQGSGMKTTG SCMPDPDIRS SYTRNAPRAL RTSNIDGYSW  240
RKYGQKQVKS PKGSRSYFRC TNTECSAKKI EICDELGHML ETVYRSQHNH DPPKKANGML  300
EGKFEKSVGP VAKHLSNNHS ARVLDDSVPS SSSKEPAQEI PAKAKSEHQN SVGFGGKGET  360
TIKNEHVNEI EHRQSGKKNK SCHSDPQPKP GKKAKIVVHA AGDVGISADG YRWRKYGQKM  420
VKGNPRPRNY YRCTSAGCPV RKQIETAVDN ANAVLITYKG VHDHDMPVPK KRHGPPSAPL  480
VAAAAPASMS SAPHKKVDAA QNGKASTKLS VDAGGELTGE AMELGGEKAM ESARTLLSIG  540
IEIKPC*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2ayd_A1e-24394467174WRKY transcription factor 1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapEucgr.C02481.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010048741.10.0PREDICTED: probable WRKY transcription factor 32 isoform X1
SwissprotP595831e-105WRK32_ARATH; Probable WRKY transcription factor 32
TrEMBLA0A059CSC00.0A0A059CSC0_EUCGR; Uncharacterized protein (Fragment)
STRINGGLYMA02G36510.11e-153(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM63382844
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G30935.12e-95WRKY DNA-binding protein 32