PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Eucgr.C01266.1.p
Common NameEUGRSUZ_C01266, LOC104439159
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family CPP
Protein Properties Length: 595aa    MW: 63151.5 Da    PI: 7.6138
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Eucgr.C01266.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR44.62.9e-14112151242
               TCR   2 ekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNkeek 42 
                       ++k+CnCk+s+Clk+YCeCfa+g +C++ C+C++C+N+ee+
  Eucgr.C01266.1.p 112 KQKQCNCKHSRCLKLYCECFASGIYCDK-CNCSNCHNNEEN 151
                       89*************************9.*********986 PP

2TCR51.22.5e-16193232140
               TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                       k++kgC+Ckks ClkkYCeCf+a+  Cse+C+C dCkN e
  Eucgr.C01266.1.p 193 KHNKGCHCKKSGCLKKYCECFQANILCSENCRCMDCKNFE 232
                       589***********************************65 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011144.7E-17111151IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163436.435112233IPR005172CRC domain
PfamPF036383.0E-11113149IPR005172CRC domain
SMARTSM011141.0E-19193234IPR033467Tesmin/TSO1-like CXC domain
PfamPF036381.4E-12196231IPR005172CRC domain
Sequence ? help Back to Top
Protein Sequence    Length: 595 aa     Download sequence    Send to blast
MGEGEAGESS PKRQQSEAGG SAPENSGAGK RLAARQLDFT RGGGGGGERE GVVLPEHPQP  60
AAAAAAAATQ PAQVVALPLP PLQASHPAVR RMESPKARPR PNVEVKEGTP KKQKQCNCKH  120
SRCLKLYCEC FASGIYCDKC NCSNCHNNEE NEAARREAVE ATLERNPNAF RPKIASSPHG  180
PRDRREDAGA LGKHNKGCHC KKSGCLKKYC ECFQANILCS ENCRCMDCKN FEGSEERQAL  240
FHGDHANNMA YIQQAANAAI TGAVGSSGFA SPPLSKKKKG QELFFGSNST VKDPSIQRLG  300
QFPQPNNTKA TAPFSLSSAP VTHGVSNTLS APSKCTYRSL LADIIQPQDV KELCSVLVVL  360
SGEVAKTLAE EKNAKEKQVA DQTEASLASS TQDRTQSLKD PDGGKTAADN CSSSSQVDKS  420
GHEESVSDSA EAPNGRPVSP GTLALMCDEQ DTMFMAAASP SGLMGHDCNS SSQVSHGQGI  480
TEVYAEQERI VLAKVRDCLN KLITFGEIKE TKYSSLARTE LGLQKDPICN GGANGKIDTG  540
HQPWLESNSI ARTSVPPPLS TQVVSTAVST SRTDNSNMSR ALENGSIQPK VEQI*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5fd3_A7e-331042422132Protein lin-54 homolog
5fd3_B7e-331042422132Protein lin-54 homolog
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtPlays a role in development of both male and female reproductive tissues. {ECO:0000250}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00045PBMTransfer from AT4G29000Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapEucgr.C01266.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAM4840282e-67AM484028.1 Vitis vinifera, whole genome shotgun sequence, contig VV78X101832.7, clone ENTAV 115.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010050570.10.0PREDICTED: protein tesmin/TSO1-like CXC 5 isoform X1
SwissprotQ9SZD10.0TCX5_ARATH; Protein tesmin/TSO1-like CXC 5
TrEMBLA0A059CP020.0A0A059CP02_EUCGR; Uncharacterized protein
STRINGXP_010050570.10.0(Eucalyptus grandis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM17832884
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G29000.11e-179Tesmin/TSO1-like CXC domain-containing protein