PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Eucgr.C00842.1.p
Common NameEUGRSUZ_C00842, LOC104436440
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family NF-YA
Protein Properties Length: 339aa    MW: 37208.7 Da    PI: 9.7519
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Eucgr.C00842.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA104.21.2e-32191247158
         CBFB_NFYA   1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 
                       d p+YVNaKQy++Il+RRq+Rak+e+++kl  k+rkpylheSRh hAl+R RgsgGrF
  Eucgr.C00842.1.p 191 DGPIYVNAKQYHGILRRRQSRAKMEAQNKL-VKARKPYLHESRHLHALNRVRGSGGRF 247
                       57****************************.**************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005219.6E-37189250IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115236.545190250IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006168.6E-24193215IPR001289Nuclear transcription factor Y subunit A
PfamPF020452.0E-27193247IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006168.6E-24224247IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 339 aa     Download sequence    Send to blast
MPIRIQNLPK KNFDQGSSLS MPHVGVTYPP WWSLNEQQLP QSLPKNSGLK AESPPMLHHQ  60
AKHLGLQLQE QESSSTQSAG NSCHEVSVVG GANSQDQSIS SESGQDESCG RSFEGQTKPI  120
FMFNNPEIVF NSSLADQNQP LIRVPYPPVD PYYGGLLTAY RPQAIIQSQV GSQMFGMAPG  180
RVPLPLNLAD DGPIYVNAKQ YHGILRRRQS RAKMEAQNKL VKARKPYLHE SRHLHALNRV  240
RGSGGRFLST KQRQQLDPAS SSHSPFATGP RDRNKDAYEP ETHQVGASER QFTSTMAGAD  300
FYPDSRFSGI STHMGGAMQC NKGLMRGSAA QHCSSSVR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_A4e-21191253264NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapEucgr.C00842.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010047514.10.0PREDICTED: nuclear transcription factor Y subunit A-3-like
RefseqXP_010047512.10.0PREDICTED: nuclear transcription factor Y subunit A-3-like
RefseqXP_010047511.10.0PREDICTED: nuclear transcription factor Y subunit A-3-like
SwissprotQ93ZH22e-43NFYA3_ARATH; Nuclear transcription factor Y subunit A-3
TrEMBLA0A059CMQ50.0A0A059CMQ5_EUCGR; Uncharacterized protein
STRINGPOPTR_0006s14740.11e-117(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM1809668
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G72830.15e-39nuclear factor Y, subunit A3