PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Eucgr.B04019.1.p
Common NameEUGRSUZ_B04019
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family LBD
Protein Properties Length: 258aa    MW: 27838.6 Da    PI: 8.965
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Eucgr.B04019.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260134.15.4e-42501501101
            DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkae 93 
                       +CaaCk+lrr+Ca++C+++pyf  ++p+kfa+vh++FGasnv+k+l+++pe++r d+++slvyeA+ r+rdPvyG++g i++lqqq+++l+a+
  Eucgr.B04019.1.p  50 PCAACKLLRRRCAEECPFSPYFSPHEPQKFAAVHRVFGASNVSKMLTEVPESQRADTANSLVYEANLRLRDPVYGCMGAISALQQQIQTLQAQ 142
                       7******************************************************************************************** PP

            DUF260  94 lallkeel 101
                       l+++++e+
  Eucgr.B04019.1.p 143 LNAVRNEI 150
                       ***99875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.80349150IPR004883Lateral organ boundaries, LOB
PfamPF031953.9E-4250147IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 258 aa     Download sequence    Send to blast
MMGVGGARER LDEIAKKIKR EKDATYGDEM GRRHMMLSLS RTGTLNTITP CAACKLLRRR  60
CAEECPFSPY FSPHEPQKFA AVHRVFGASN VSKMLTEVPE SQRADTANSL VYEANLRLRD  120
PVYGCMGAIS ALQQQIQTLQ AQLNAVRNEI LRFKYREAVT TNHVQSNVVV PHSRTALNPT  180
AALAVSVVPP PTLSSSSSTA APPDPSPPPL PPPPSLVVPS SSSSSSSTSS LFTTPTSTTT  240
YSSISSETNT VHYFETI*
Cis-element ? help Back to Top
SourceLink
PlantRegMapEucgr.B04019.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010045408.10.0PREDICTED: LOB domain-containing protein 15-like
SwissprotQ8L5T58e-74LBD15_ARATH; LOB domain-containing protein 15
TrEMBLA0A059DAZ40.0A0A059DAZ4_EUCGR; Uncharacterized protein
STRINGVIT_13s0067g02380.t012e-90(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM19272781
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40470.12e-72LOB domain-containing protein 15